DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2656 and CG3704

Sequence 1:NP_649699.1 Gene:CG2656 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_569872.1 Gene:CG3704 FlyBaseID:FBgn0040346 Length:382 Species:Drosophila melanogaster

Alignment Length:332 Identity:85/333 (26%)
Similarity:135/333 (41%) Gaps:72/333 (22%)


  Fly     6 IIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMEDEELHY 70
            :::|.|||||:|:...:.|:|.: |.|..|||||||.....|....||||.::..:.|:..:|  
  Fly    27 LVLGMAGSGKTTFTQKLIQHAQE-KFNPYVVNLDPACREVPYAAHVDIRDTVNYREVMKQYQL-- 88

  Fly    71 GPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLKMGRQLVELL 135
            |||||::..|...........|.:      ...||....:.:.|.|||||:|.....|..:.|.|
  Fly    89 GPNGGIVTALNMFTTKMAQFAELV------RRAGERGHKWCVIDTPGQIEVFNWSASGSIITEGL 147

  Fly   136 ESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDL----LSSDARKQLE 196
            .:. |.|.||:.:|.:.......|:|..:.|.|::.....|.:..|.|:||    ...|.....|
  Fly   148 ATM-FPTIVVYVMDVERSACPTTFMSNMLYACSILYKTRLPFLVALNKIDLKDCGFVMDWMTDFE 211

  Fly   197 MYLE--PDAHSLMGELT----------------------IGTGFGEKYAKLTQAIGALIEDFSLV 237
            .:.|  .:.||.:..||                      .|.||.:...|:.:::.....|:..|
  Fly   212 AFQEAQEEEHSFVSNLTRTMSLTLDTFYENLRTCGVSAKTGVGFTQLLTKILESVDEYETDYKPV 276

  Fly   238 -------RFF-------PLDSQDEE--------SVGD--------LLLQIDSILQYGEDADVNVK 272
                   |..       |:|..:|:        |:.|        :.|...|::.  |.|:  ::
  Fly   277 YEKKRQERLAESATGPKPVDHVEEDGHAVPLGLSLQDPPPHTGNSIFLMAPSLVP--ESAE--IE 337

  Fly   273 DFDEPEE 279
            |.:|.||
  Fly   338 DEEEMEE 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 59/194 (30%)
ATP_bind_1 7..263 CDD:281079 79/314 (25%)
CG3704NP_569872.1 Gem1 24..199 CDD:224025 58/182 (32%)
ATP_bind_1 28..268 CDD:281079 69/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8219967
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21231
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.