DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2656 and fet5

Sequence 1:NP_649699.1 Gene:CG2656 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_594965.1 Gene:fet5 PomBaseID:SPAC4D7.12c Length:276 Species:Schizosaccharomyces pombe

Alignment Length:287 Identity:127/288 (44%)
Similarity:182/288 (63%) Gaps:17/288 (6%)


  Fly     1 MRFAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMED 65
            ::.|..:.|.|.|||||:|..:..|.....|:..:||||||||:|.:.|..||||||.:||.|  
pombe     2 VKVAAFVCGVASSGKSTFCGALMSYMKSVGRSCHLVNLDPAAENFEWEPTVDIRDLISIDDVM-- 64

  Fly    66 EELHYGPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLKMGRQ 130
            |||.||||||||:|.|||:||.:||.|:         :|:.|:||::|||||||||:||:.:...
pombe    65 EELDYGPNGGLIYCFEFLMENLDWLNEE---------IGDYDEDYLIFDMPGQIELYTHVPILPA 120

  Fly   131 LVELLE-SWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSD---A 191
            |:..|: :.|||.|.|:.|:|||:||..||.:|.::|:|.|..||.||||:|:|:|||..:   .
pombe   121 LIRHLQVTLNFRPCAVYLLESQFLVDRTKFFAGVLSAMSAMVMMEVPHINLLSKMDLLKDNNNIT 185

  Fly   192 RKQLEMYLEPDAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQ 256
            :.:|:.:|..|...|.||:...|  ..|:.:|.:.|..||:||::|.|.||:|.:||||..:|..
pombe   186 KAELKRFLNTDPLLLTGEINETT--NPKFHELNRCIVQLIDDFNMVNFLPLESGNEESVSRVLSY 248

  Fly   257 IDSILQYGEDADVNVKDFDEPEEGDQD 283
            ||...|:.||.:....|..|.::.:.|
pombe   249 IDDATQWYEDQEPKDPDRFEADDLEDD 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 96/198 (48%)
ATP_bind_1 7..263 CDD:281079 121/260 (47%)
fet5NP_594965.1 Gem1 1..197 CDD:224025 98/206 (48%)
ATP_bind_1 8..255 CDD:281079 121/260 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6487
Inparanoid 1 1.050 237 1.000 Inparanoid score I820
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004261
OrthoInspector 1 1.000 T1125310
orthoMCL 1 0.900 OOG5_128003
Panther 1 1.100 LDO PTHR21231
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R521
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.