DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2656 and Y75B8A.14

Sequence 1:NP_649699.1 Gene:CG2656 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_499587.1 Gene:Y75B8A.14 WormBaseID:WBGene00013550 Length:272 Species:Caenorhabditis elegans

Alignment Length:283 Identity:137/284 (48%)
Similarity:197/284 (69%) Gaps:14/284 (5%)


  Fly     1 MRFAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMED 65
            |::||:::||||||||||||:|..:.:...|.:::||||||.|.|.|..:.|:||||.::|..||
 Worm     1 MKYAQLVMGPAGSGKSTYCSVMYNHCLSTGRTLRMVNLDPACEVFNYPAVVDVRDLISVNDVQED 65

  Fly    66 EELHYGPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLKMGRQ 130
            |||..||||.|:||:|:|::|.|||.::|..||         |||.:.|.||||||::||.:.||
 Worm    66 EELILGPNGALVFCMEYLVQNLEWLHDELDEGE---------DDYFVIDCPGQIELYSHLPVMRQ 121

  Fly   131 LVELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDARKQL 195
            :|:.|:||:|..|.||.:|:.|::|..|||||.:.|||.|..:|.|.||||||:||||...::.:
 Worm   122 IVDALKSWDFNVCSVFLIDTNFVLDAEKFISGALTALSAMVAIETPAINVLTKMDLLSERNKQLV 186

  Fly   196 EMYLEPDAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQIDSI 260
            :.:||.|..|::.:  ..|.:..|:.|||:.|..::||:|:|:|.||:.:||||:..|||.||:.
 Worm   187 DEFLETDTRSIVDQ--DETVWNSKHRKLTRTIAQVLEDYSIVKFVPLNCEDEESIDQLLLTIDTT 249

  Fly   261 LQYGEDADVNVKDFDEPEEGDQD 283
            :||||  |:.||| ..|||.|.:
 Worm   250 IQYGE--DLEVKD-HYPEELDPE 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 98/194 (51%)
ATP_bind_1 7..263 CDD:281079 123/256 (48%)
Y75B8A.14NP_499587.1 Gem1 2..203 CDD:224025 102/212 (48%)
ATP_bind_1 7..252 CDD:281079 123/256 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8186829
eggNOG 1 0.900 E1_KOG1534
Hieranoid 1 1.000
Homologene 1 1.000 H6487
Inparanoid 1 1.050 273 1.000 Inparanoid score I1786
Isobase 1 0.950 0 Normalized mean entropy S519
OMA 1 1.010
OrthoDB 1 1.010 D432496at33208
OrthoFinder 1 1.000 FOG0004261
OrthoInspector 1 1.000 T474697
orthoMCL 1 0.900 OOG5_128003
Panther 1 1.100 LDO PTHR21231
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R521
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.