DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2656 and B0207.6

DIOPT Version :9

Sequence 1:NP_649699.1 Gene:CG2656 / 40857 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_491713.2 Gene:B0207.6 / 172267 WormBaseID:WBGene00015029 Length:268 Species:Caenorhabditis elegans


Alignment Length:280 Identity:91/280 - (32%)
Similarity:142/280 - (50%) Gaps:24/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMEDEE 67
            :..:::|..|:||||:|:.:.......||....:|||||.:...|.|..:|.::|.::|.|  :.
 Worm     2 YGVLVIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVNDVM--DR 64

  Fly    68 LHYGPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLKMGRQLV 132
            |..||||.|.:|:|.|..|..||.:::.....:         |::.|.|||:||:.......:::
 Worm    65 LGLGPNGALKYCIETLGANCNWLLQKIEANHKK---------YLIIDCPGQLELYKSEGELWKVI 120

  Fly   133 ELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDARKQLEM 197
            ..||....|.|.:...||.:..|.:||||..::.|:.|..||.|.:|.|:|.||.|.|....||.
 Worm   121 RFLEKSGVRLCALHLADSLYCSDPSKFISVALSTLATMVTMEMPQVNCLSKADLFSEDGTYDLEF 185

  Fly   198 YLE-PDAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQIDSIL 261
            :.. ||.:.|:..|....|. |||.||.:||..:|.||.||.|.||..:::||:..::..:|:  
 Worm   186 FSHLPDVNRLLDLLNEVPGL-EKYRKLNEAICGVISDFDLVSFVPLAVENKESMMKVIQMVDA-- 247

  Fly   262 QYGEDADVNVKDFDEPEEGD 281
                     ...|...|:||
 Worm   248 ---------ANGFSLTEQGD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 62/192 (32%)
ATP_bind_1 7..263 CDD:281079 87/256 (34%)
B0207.6NP_491713.2 Gem1 4..174 CDD:224025 58/180 (32%)
ATP_bind_1 6..251 CDD:281079 87/267 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432496at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.