DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2656 and AgaP_AGAP004824

DIOPT Version :9

Sequence 1:NP_649699.1 Gene:CG2656 / 40857 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_317984.3 Gene:AgaP_AGAP004824 / 1278404 VectorBaseID:AGAP004824 Length:871 Species:Anopheles gambiae


Alignment Length:245 Identity:49/245 - (20%)
Similarity:94/245 - (38%) Gaps:54/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HLD-------DAMEDEELHYGPNGGLIFCLEFLIENQEWLKEQ--LCGGENELMVGEPDDDYILF 113
            |:|       |.:....:..|..||:...:.......|.:|||  ...|..||....|  ..::.
Mosquito   290 HVDTGKTKILDKLRRTNVQDGEAGGITQQIGATNVPSENIKEQTRFVKGFQELEFKLP--GLLII 352

  Fly   114 DMPGQIELFTHLK-MGRQLVELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPH 177
            |.||. |.|::|: .|..|.::         .:..:|   ::.|.:  ..|:.:::::.:...|.
Mosquito   353 DTPGH-ESFSNLRSRGSSLCDI---------AILVVD---IMHGLE--PQTIESINLLKSKRTPF 402

  Fly   178 INVLTKVDLL---SSDARKQLEMYLEPDAHSLMGELTIGTGFGEKYAKL-----TQAIGALI--- 231
            :..|.|:|.|   ::..||.:...|:..|.:...|      |.::..::     .|.:.|.:   
Mosquito   403 VVALNKIDRLYDWNTMPRKDVRDILKAQASNTQLE------FNQRTKEIIVQFAEQGLNAALFYE 461

  Fly   232 --EDFSLVRFFPLDSQDEESVGDLLL--------QIDSILQYGEDADVNV 271
              :..:.|...|..:...|.:|::|.        |:...|.|.||....|
Mosquito   462 NPDPKTYVSLVPTSAITGEGMGNMLFLIVQFCQKQLAKRLMYSEDLQATV 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 32/150 (21%)
ATP_bind_1 7..263 CDD:281079 45/235 (19%)
AgaP_AGAP004824XP_317984.3 PRK04004 278..855 CDD:235195 49/245 (20%)
IF2_eIF5B 284..495 CDD:206674 43/227 (19%)
aeIF5B_II 507..616 CDD:293904 1/5 (20%)
IF-2 617..720 CDD:288813
IF2_aeIF5B_IV 743..837 CDD:293911
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.