DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2656 and LOC100490887

DIOPT Version :9

Sequence 1:NP_649699.1 Gene:CG2656 / 40857 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_002936617.2 Gene:LOC100490887 / 100490887 -ID:- Length:1077 Species:Xenopus tropicalis


Alignment Length:138 Identity:34/138 - (24%)
Similarity:55/138 - (39%) Gaps:35/138 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LSVMANMEQPHINVLTKVDLLSSDAR----KQLEMYLEPDAHSLMGELT------------IGTG 215
            |:|:|..:.|.:.:....|.|||.|.    |...:..........|::|            ||.|
 Frog   166 LTVLAMDQVPRVTIAQGYDALSSMANIAGYKATVLAANHFGRFFTGQITAAGKVPPAKVLIIGGG 230

  Fly   216 F-GEKYAKLTQAIGALIEDF-----SLVRFFPLDSQDEESVGDLLLQIDSILQYGED----ADVN 270
            . |...|...:|:||::..|     :|.:|        :|:|...|::: |.:.||.    |...
 Frog   231 VAGLAAAGAAKAMGAIVRGFDTRPPALEQF--------KSLGAEPLEVE-IAETGEGVGGYAKEM 286

  Fly   271 VKDFDEPE 278
            .|:|.|.|
 Frog   287 SKEFIEAE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 10/32 (31%)
ATP_bind_1 7..263 CDD:281079 27/117 (23%)
LOC100490887XP_002936617.2 pntA 53..581 CDD:236507 34/138 (25%)
PNTB 616..1070 CDD:376743
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165178209
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.