DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2656 and gpn3

Sequence 1:NP_649699.1 Gene:CG2656 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001007371.1 Gene:gpn3 ZFINID:ZDB-GENE-040724-141 Length:285 Species:Danio rerio

Alignment Length:282 Identity:150/283 (53%)
Similarity:202/283 (71%) Gaps:15/283 (5%)


  Fly     2 RFAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMEDE 66
            |:||:::|||||||||||:.|.::.....|:|||||||||||||.|..:.|||:||.:||.|||:
Zfish     3 RYAQLVMGPAGSGKSTYCATMLEHCQALNRSVQVVNLDPAAEHFEYPVIADIRELIQVDDVMEDD 67

  Fly    67 ELHYGPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLKMGRQL 131
            .|.:|||||||||:|:...|.:||:|.|         |..:|||||||.||||||:|||.:.:||
Zfish    68 SLRFGPNGGLIFCMEYFSNNFDWLEESL---------GHVEDDYILFDCPGQIELYTHLPVMKQL 123

  Fly   132 VELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDARKQLE 196
            ||.|:.|.||.|.||.:||||||:..|||||.|||||.|..:|.|.:|::||:||||..|:|::|
Zfish   124 VEQLQQWEFRVCGVFLVDSQFMVETFKFISGVMAALSAMVMLEIPQVNIMTKMDLLSPKAKKEIE 188

  Fly   197 MYLEPDAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQIDSIL 261
            .||:||.:|:|.:.::... .:|::|||:||..||:|:|:|||.|.|..|||.:..:|..||..:
Zfish   189 KYLDPDMYSMMEDNSVALR-SKKFSKLTKAICGLIDDYSMVRFLPFDRTDEEGINIVLQHIDFSI 252

  Fly   262 QYGEDADVNVKDFDEPEEGDQD 283
            |||||.:|.     ||:|.|::
Zfish   253 QYGEDLEVK-----EPKEVDEE 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 112/194 (58%)
ATP_bind_1 7..263 CDD:281079 138/256 (54%)
gpn3NP_001007371.1 Gem1 1..192 CDD:224025 115/198 (58%)
ATP_bind_1 8..254 CDD:281079 138/256 (54%)
Gly-Pro-Asn (GPN)-loop, involved in dimer interface. {ECO:0000250|UniProtKB:Q9UYR9} 72..74 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8217300
eggNOG 1 0.900 E1_KOG1534
Hieranoid 1 1.000
Homologene 1 1.000 H6487
Inparanoid 1 1.050 304 1.000 Inparanoid score I2587
OMA 1 1.010
OrthoDB 1 1.010 D432496at33208
OrthoFinder 1 1.000 FOG0004261
OrthoInspector 1 1.000 T1053462
orthoMCL 1 0.900 OOG5_128003
Panther 1 1.100 LDO PTHR21231
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R521
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.