DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10098 and SCRN1

DIOPT Version :8

Sequence 1:NP_649694.1 Gene:CG10098 / 40851 FlyBaseID:FBgn0037472 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001138986.1 Gene:SCRN1 / 9805 HGNCID:22192 Length:434 Species:Homo sapiens

Alignment Length:422 Identity:110/423 (26%)
Similarity:182/423 (43%) Gaps:90/423 (21%)


  Fly     6 CFVVLPENCAEGTLIIGRNA---EDEKNVNVASEVCFYDATE-VLEGKTD-GGASAETGGDMLRV 65
            |||..|....:|.::.|:|:   .||     ..||.::.|.: ..|.|.: ...|.:.......:
Human    29 CFVAFPPRAKDGLVVFGKNSARPRDE-----VQEVVYFSAADHEPESKVECTYISIDQVPRTYAI 88

  Fly    66 ILQKPQPGLWGGDFGANERGVALGLTWAAGENEAKDSDSLLGTDIVRLTLAVAKDVDDAVDRIGA 130
            ::.:| ..|||.:.||||.||.:..........|.:.::|||.|:|||.|...:...:|:|.|.:
Human    89 MISRP-AWLWGAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERGETAKEALDVIVS 152

  Fly   131 LVASHGHDNSKLN-----------FIACDAAAAWLVSCSGKVWAAEKLEASFLRLPSGGLAVTTV 184
            |:..||...:...           ::..|...||::...||.|||||:... :|.....|::||.
Human   153 LLEEHGQGGNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAAEKVTEG-VRCICSQLSLTTK 216

  Fly   185 VNKSSEGLDDAASFAAAHD----------AEAQAPAVDW--CGPKPAGDGTYTQHDMFETLRSAS 237
            ::.....|   .|:|.:..          :|..:|..|.  ||   ||..:..:.:...|:::..
Human   217 MDAEHPEL---RSYAQSQGWWTGEGEFNFSEVFSPVEDHLDCG---AGKDSLEKQEESITVQTMM 275

  Fly   238 NASSSRAATVSV------LSVKGIS---------C-HWFTGTPNAAESVFKPFVFAPNPRISPLT 286
            |....:|:.|.:      .:..|:|         | |:|||||:.:.|:||||:|..:.::.|.|
Human   276 NTLRDKASGVCIDSEFFLTTASGVSVLPQNRSSPCIHYFTGTPDPSRSIFKPFIFVDDVKLVPKT 340

  Fly   287 Q---------------VQAEADLT-LLHKLHSQRKPAALE-------HLRS----LE---LSCVD 321
            |               .|.:.|.. .|:|.|...: |.:|       .|||    ||   |..::
Human   341 QSPCFGDDDPAKKEPRFQEKPDRRHELYKAHEWAR-AIIESDQEQGRKLRSTMLELEKQGLEAME 404

  Fly   322 ELNNYFSLQDHASDELDELLKDCVEAEVKFYR 353
            |:.......|.|  |:.:|..|||:.|:||::
Human   405 EILTSSEPLDPA--EVGDLFYDCVDTEIKFFK 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10098NP_649694.1 Ntn_hydrolase 73..>169 CDD:294319 34/107 (32%)
SCRN1NP_001138986.1 Ntn_hydrolase 38..>247 CDD:294319 54/219 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C41193296
eggNOG 1 0.900 E1_COG4690
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I4807
Isobase 1 0.950 0 Normalized mean entropy S7996
OMA 1 1.010
OrthoDB 1 1.010 D322959at2759
OrthoFinder 1 1.000 FOG0001498
OrthoInspector 1 1.000 T609803
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12994
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.820

Return to query results.
Submit another query.