DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10098 and scrn3

DIOPT Version :8

Sequence 1:NP_649694.1 Gene:CG10098 / 40851 FlyBaseID:FBgn0037472 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_009302703.1 Gene:scrn3 / 326058 ZFINID:ZDB-GENE-030131-4783 Length:429 Species:Danio rerio

Alignment Length:422 Identity:118/423 (28%)
Similarity:176/423 (42%) Gaps:88/423 (21%)


  Fly     5 DCFVVLPENCAEGTLIIGRNAE---DEKNVNVASEVCFYDATEVLEGKTD-GGASAETGGDMLRV 65
            |.||.||.:.....:|.|:|::   ||     ..||.::.|.|...||.: .....|.......|
Zfish    19 DTFVALPPSTEGQRIIFGKNSDRPCDE-----VQEVVYFPAKEHEPGKVECTYIEIEQVEKTFAV 78

  Fly    66 ILQKPQPGLWGGDFGANERGVALGLTWAAGENEAKDSDSLLGTDIVRLTLAVAKDVDDAVDRIGA 130
            :|.:| ..|||.:.||||..|.:|.....|...|...::|||.|:|||.|..|...:.|||.|..
Zfish    79 VLSRP-AWLWGAEMGANEHQVCIGNEAVWGRESADGDEALLGMDLVRLALERADTAEKAVDVITD 142

  Fly   131 LVASHGHDNSKL----------NFIACDAAAAWLVSCSGKVWAAEKLEASFLRLPSGGLAVTTVV 185
            |:..:|...:.:          :|:..|...||::..:||.||||::||.:..: |...::||.:
Zfish   143 LLEKYGQGGNCMEDECGFTYHNSFLISDRKEAWVLETAGKHWAAERVEAGYRNI-SNQYSITTKI 206

  Fly   186 NKSSEGL------------------DDAASFAAAHDAEAQAPAVDWC-GPK--PAGDGTYTQHDM 229
            :|...|:                  .|..|:::.  |..||....:| |.|  ...:|..:...|
Zfish   207 DKEHPGMRTYAKEQGWWDGESEFSFTDVYSYSST--ARIQAAGGRYCEGQKLLQKSNGHISAQTM 269

  Fly   230 FETLR---SASNASSSRAATVSVLSV-------KGISCHWFTGTPNAAESVFKPFVFAPNPRISP 284
            .:.||   |..|......:|.|::||       .|:  |:||.||:...||||||||..:  :.|
Zfish   270 MDILRDKESGINMEGMFMSTGSMVSVIPKADHLPGV--HFFTATPDPERSVFKPFVFVSD--VPP 330

  Fly   285 LTQVQA----EADLTLLHKLHSQRKP-------------AAL------------EHLRSLELSCV 320
            |....:    |.| .:..|...|.||             ||:            :.:|.||...:
Zfish   331 LKHTSSPCFGEED-PVKKKPRFQSKPNRKHPLFLKHEVAAAIIDSSGERGQKIEKEMRDLEKQKL 394

  Fly   321 DELNNYFSLQDHASDELDELLKDCVEAEVKFY 352
            :|:..|.:.....|..|..|..|.||.|...|
Zfish   395 EEMEKYLTEGVEDSSLLVHLFTDTVEEEFSVY 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10098NP_649694.1 Ntn_hydrolase 73..>169 CDD:294319 37/106 (35%)
scrn3XP_009302703.1 Ntn_hydrolase 17..>330 CDD:294319 95/324 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C41193040
eggNOG 1 0.900 E1_COG4690
Hieranoid 1 1.000
Homologene 1 1.000 H11601
Inparanoid 1 1.050 110 1.000 Inparanoid score I4795
OMA 1 1.010
OrthoDB 1 1.010 D322959at2759
OrthoFinder 1 1.000 FOG0001498
OrthoInspector 1 1.000 T597484
orthoMCL 1 0.900 OOG5_136416
Panther 1 1.100 O PTHR12994
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5455
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.