DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10098 and Scrn3

DIOPT Version :8

Sequence 1:NP_649694.1 Gene:CG10098 / 40851 FlyBaseID:FBgn0037472 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_006234420.1 Gene:Scrn3 / 311731 RGDID:1305064 Length:418 Species:Rattus norvegicus

Alignment Length:421 Identity:112/422 (27%)
Similarity:174/422 (41%) Gaps:86/422 (20%)


  Fly     5 DCFVVLPENCAEGTLIIGRNAE---DEKNVNVASEVCFYDAT--EVLEGK-----TDGGASAETG 59
            |.||.||.......:|.|:|::   ||     ..||.::.|.  ..||.:     .:.....|| 
  Rat     7 DTFVALPPATVGNRVIFGKNSDRLFDE-----VQEVIYFPAAVHSDLEKRLKCTYIEVDQVPET- 65

  Fly    60 GDMLRVILQKPQPGLWGGDFGANERGVALGLTWAAGENEAKDSDSLLGTDIVRLTLAVAKDVDDA 124
               ..|:|.:| ..|||.:.||||.||.:|.....|..:....::|||.|:|||.|..|...:.|
  Rat    66 ---YAVVLSRP-AWLWGAEMGANEHGVCIGNEAIWGREDISKEEALLGMDLVRLGLERADTAEKA 126

  Fly   125 VDRIGALVASHGHDNSKL---------NFIACDAAAAWLVSCSGKVWAAEKLEASFLRLPSGGLA 180
            ::.|..|:..:|...:..         :|:..|...||::..|||.|||||::.  :|..|...:
  Rat   127 LNVIVDLLGKYGQGGNCAEGEEFSYYNSFLIADRNEAWILETSGKFWAAEKVQG--VRNISNQFS 189

  Fly   181 VTTVVNK----------------SSEGLDDAASFAAAHDAEAQAPAVDWC-GPKPAG--DGTYTQ 226
            :||.:::                ..|..|.||:::....|........:| |.|...  .|..|.
  Rat   190 ITTKIDREHPDMRNYAKQRGWWDGKEEFDFAAAYSYTDTATMMTSPSRYCQGHKLLNKHKGNITY 254

  Fly   227 HDMFETLR---SASNASSSRAATVSVLSV----KGISC-HWFTGTPNAAESVFKPFVFAPNPRIS 283
            ..|.|.||   |..|.......|.|::|:    ..:.| |..||||:...||||||:|.|:  :|
  Rat   255 ETMVEILRDRPSGINMKGEFLTTASMVSILPQDPSLPCIHLLTGTPHPERSVFKPFIFVPH--VS 317

  Fly   284 PLTQVQA-----EADLT-----------LLHKLHSQ----------RKPAALEHLRSLELSCVDE 322
            ||...::     |..:.           ||::.|.|          :....|:::|.||....:|
  Rat   318 PLLDTKSPTFELERPVAKKPYVKPDRRHLLYQNHQQALEMISNHKEKGKTILDNVRKLEKEVFEE 382

  Fly   323 LNNYFSLQDHASDELDELLKDCVEAEVKFYR 353
            :.:....:....|:...|....|..|:|.|:
  Rat   383 IESILQNRHLDMDKTVNLFPQYVRDEIKIYQ 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10098NP_649694.1 Ntn_hydrolase 73..>169 CDD:294319 36/105 (34%)
Scrn3XP_006234420.1 Ntn_hydrolase 5..>224 CDD:294319 64/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C41193082
eggNOG 1 0.900 E1_COG4690
Hieranoid 1 1.000
Homologene 1 1.000 H11601
Inparanoid 1 1.050 99 1.000 Inparanoid score I4837
OMA 1 1.010
OrthoDB 1 1.010 D322959at2759
OrthoFinder 1 1.000 FOG0001498
OrthoInspector 1 1.000 T618732
orthoMCL 1 0.900 OOG5_136416
Panther 1 1.100 O PTHR12994
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.