DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10098 and Scrn2

DIOPT Version :8

Sequence 1:NP_649694.1 Gene:CG10098 / 40851 FlyBaseID:FBgn0037472 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_017169969.1 Gene:Scrn2 / 217140 MGIID:1343092 Length:443 Species:Mus musculus

Alignment Length:452 Identity:113/453 (25%)
Similarity:158/453 (35%) Gaps:144/453 (32%)


  Fly     5 DCFVVLPENCAEGTLIIGRNAE---DEKNVNVASEVCFYDATEVLEGKTDGGA-------SAETG 59
            ||||.:|...|...:|..:|::   ||     ..||.|..|     |....|:       ..|..
Mouse    31 DCFVSVPPASAIPAVIFAKNSDRPRDE-----VQEVVFIPA-----GTHVPGSRLQCTYIEVEQV 85

  Fly    60 GDMLRVILQKPQPGLWGGDFGANERGVALG--LTWA---AGENEAKDSDSLLGTDIVRLTLAVAK 119
            |....|||.:|. .|||.:.||||.||.:|  ..|.   .|:.||     |||.|::||.|..:.
Mouse    86 GKTHAVILSRPS-WLWGAEMGANELGVCIGNEAVWTKEPVGQGEA-----LLGMDLLRLALERSS 144

  Fly   120 DVDDAVDRIGALVASHGHDNS----------KLNFIACDAAAAWLVSCSGKVWAAEKLEASFLRL 174
            ...:||..|..|:..:|...|          ...|:..|...||::..:|.:|||::::      
Mouse   145 TAQEAVHVIAGLLDRYGQGGSCREDPEPFCYHNTFLLADRTEAWVLETAGSLWAAQRIQ------ 203

  Fly   175 PSGGLAVTTVVNKSSEGLDDAASFAAAH-DAEAQAPAVDW------------------------- 213
              ||  ...:.|:.|.|.|    .:|.| :..:.|.|..|                         
Mouse   204 --GG--ARNISNQLSIGTD----ISAEHPELRSHAKAQGWWTGQGLFDFAEVFSLTQQPVRMEAA 260

  Fly   214 -------CGPKPAGDGTYTQHDMFETLRSA-------SNASSSRAATVSVLSVKGIS-C-HWFTG 262
                   |.......|..|...|...||..       |....:.|:.||||...... | |:.|.
Mouse   261 KARFRAGCEMLQRHQGNITAEVMMGILRDKESGICMDSGGFRTTASMVSVLPQDPTKPCVHFLTA 325

  Fly   263 TPNAAESVFKPFVF----------------APNP-RISPLTQVQAEADLTL-------------- 296
            ||:.:.||||||:|                |.:| ||.|..|.:.:...:|              
Mouse   326 TPDPSRSVFKPFIFEVGVSQSPQVLSPTFGAQDPVRILPRFQTRVDRRHSLYRGHQAALGLMEDE 390

  Fly   297 ------LHKLHSQRKPAALEHLRSLELSCVDELNNYFSLQDHASDELDELLKDCVEAEVKFY 352
                  |.|...:.:...||.||.|          ....|...:..|..|.:..||.|.:.|
Mouse   391 QEQAQQLRKKQQRLEQEGLEALRGL----------LTGEQTPPAQGLGSLFQAFVEREEQAY 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10098NP_649694.1 Ntn_hydrolase 73..>169 CDD:294319 35/111 (32%)
Scrn2XP_017169969.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C41197491
eggNOG 1 0.900 E1_COG4690
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4892
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001498
OrthoInspector 1 1.000 T616612
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12994
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5455
TreeFam 1 0.960
1110.890

Return to query results.
Submit another query.