powered by:
                   
 
    
    
             
          
            Protein Alignment CG10098 and arx-4
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_649694.1 | Gene: | CG10098 / 40851 | FlyBaseID: | FBgn0037472 | Length: | 353 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001370783.1 | Gene: | arx-4 / 175247 | WormBaseID: | WBGene00021170 | Length: | 301 | Species: | Caenorhabditis elegans | 
        
        
        
          
            | Alignment Length: | 174 | Identity: | 37/174 - (21%) | 
          
            | Similarity: | 62/174 -  (35%) | Gaps: | 64/174 - (36%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    18 TLIIGRNAEDEKNVNVASEVCFYDATEVLEGKTDGGASAETGGDMLRVILQKPQPGLWGGDFGAN 82|:.|...|:   .|.|.....|.||.:|:.||               |.||:.:.       |..
 Worm   152 TMYIEAKAD---RVTVIFSTVFKDADDVIIGK---------------VFLQEFRE-------GRK 191
 
 
  Fly    83 ERGVALGLTWAAGEN--EAKD-SDSLLGTDIVRLTLAV------AKDVDDAVDRIGALVAS---- 134....|..:.::.||.  |.|| .::.:|.::..:|..:      .|..|:.:|    |:.|
 Worm   192 ASQTAPAVLYSLGEPPLELKDLPEARVGDNVGYITFVLFPRHTNKKTKDNTID----LIHSFRDY 252
 
 
  Fly   135 -HGHDNSKLNFIACDAAAAWLVSCSGKVWAAEKLEA---SFLRL 174|.|                 :.|| ||:...::.|   .||::
 Worm   253 LHYH-----------------IKCS-KVYLHTRMRAKTTDFLKV 278
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_COG4690 | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 1 | 0.900 |  | 
        
      
           
             Return to query results.
             Submit another query.