DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10098 and arx-4

DIOPT Version :9

Sequence 1:NP_649694.1 Gene:CG10098 / 40851 FlyBaseID:FBgn0037472 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001370783.1 Gene:arx-4 / 175247 WormBaseID:WBGene00021170 Length:301 Species:Caenorhabditis elegans


Alignment Length:174 Identity:37/174 - (21%)
Similarity:62/174 - (35%) Gaps:64/174 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TLIIGRNAEDEKNVNVASEVCFYDATEVLEGKTDGGASAETGGDMLRVILQKPQPGLWGGDFGAN 82
            |:.|...|:   .|.|.....|.||.:|:.||               |.||:.:.       |..
 Worm   152 TMYIEAKAD---RVTVIFSTVFKDADDVIIGK---------------VFLQEFRE-------GRK 191

  Fly    83 ERGVALGLTWAAGEN--EAKD-SDSLLGTDIVRLTLAV------AKDVDDAVDRIGALVAS---- 134
            ....|..:.::.||.  |.|| .::.:|.::..:|..:      .|..|:.:|    |:.|    
 Worm   192 ASQTAPAVLYSLGEPPLELKDLPEARVGDNVGYITFVLFPRHTNKKTKDNTID----LIHSFRDY 252

  Fly   135 -HGHDNSKLNFIACDAAAAWLVSCSGKVWAAEKLEA---SFLRL 174
             |.|                 :.|| ||:...::.|   .||::
 Worm   253 LHYH-----------------IKCS-KVYLHTRMRAKTTDFLKV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10098NP_649694.1 Ntn_hydrolase 73..>169 CDD:294319 20/109 (18%)
arx-4NP_001370783.1 P34-Arc 57..286 CDD:397935 37/174 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.