DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and crip2

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_998662.2 Gene:crip2 / 554826 ZFINID:ZDB-GENE-040426-2889 Length:206 Species:Danio rerio


Alignment Length:214 Identity:77/214 - (35%)
Similarity:100/214 - (46%) Gaps:41/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 APKCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYC-KTCHGRKFGPKG 72
            |.|||:|.|:||.||:..:.|..:||.|.||..|:|:|.:....||:.:.|| |.|:...|||||
Zfish     2 ASKCPKCEKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTAGGHAEHDGKPYCHKPCYAALFGPKG 66

  Fly    73 YGFGTGAGTLSMD---NGSQFLRENGDVPSVRNGARLEPRA-------IARAPEGEG-------- 119
            ...| |||:...:   |.|         |...||.. .|:|       .:|.|...|        
Zfish    67 VNIG-GAGSYVYEAPTNTS---------PPPNNGDS-APKAQEKWVPVSSRPPSKAGSITTFSGE 120

  Fly   120 ---CPRCGGYVYAAEQMLARGRSWHKECFKCGTCKKGLDSILCCEAPDKNIYC-KGCYAKKFGPK 180
               ||||...||.||::.:.|:.||:.|.:|..|.|.|.:....| .|...|| |.|||..||||
Zfish   121 ANLCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCSKTLAAGSHAE-HDGQPYCHKPCYAVLFGPK 184

  Fly   181 GYGYGQGGGALQSDCYAHD 199
            |...|..|.      |.:|
Zfish   185 GVNTGGVGS------YIYD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 23/53 (43%)
LIM_CRP_like 120..173 CDD:188712 21/53 (40%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
crip2NP_998662.2 LIM1_TLP 5..58 CDD:188860 22/52 (42%)
LIM_TLP_like 124..177 CDD:188785 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.