DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mlp84B and Crip3

Sequence 1:NP_001303418.1 Gene:Mlp84B FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001102773.1 Gene:Crip3 RGDID:1565018 Length:204 Species:Rattus norvegicus

Alignment Length:219 Identity:73/220 (33%)
Similarity:92/220 (42%) Gaps:57/220 (26%)


  Fly    12 CPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYC-KTCHGRKFGPKGYGF 75
            ||||.:.||.||:..:.|..:|:.|.||..|:..|......||....|| |.|:|..|||:|...
  Rat     5 CPRCQQPVYFAEKVSSVGKHWHRFCLKCERCHSILSPGGHAEHNGRPYCHKPCYGALFGPRGVNI 69

  Fly    76 GTGAG---------------TLSMDNGSQFLRENGDVPSVRNGARLEPRAIARAP-------EGE 118
            | |.|               :||..|.|.        |..|.|.   |||....|       |..
  Rat    70 G-GVGCYLYNPPSPPPASSISLSPSNFSP--------PRPRTGL---PRAKKSPPYLKTFTGETS 122

  Fly   119 GCPRCGGYVYAAEQMLARGRSWHKECFKCGTCKKGL--------DSILCCEAPDKNIYCKGCYAK 175
            .||.||..||.||::::.||:||:.|.:|..|:|.|        |.:..|..|        ||..
  Rat   123 LCPGCGDPVYFAEKVMSLGRNWHRPCLRCQRCRKTLTAGSHAEHDGMPYCHIP--------CYGY 179

  Fly   176 KFGPKGYGYGQGGGALQSDCYAHD 199
            .|||||...|..|      ||.:|
  Rat   180 LFGPKGVNIGDVG------CYIYD 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 21/53 (40%)
LIM_CRP_like 120..173 CDD:188712 21/61 (34%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Crip3NP_001102773.1 LIM1_TLP 5..58 CDD:188860 21/53 (40%)
LIM 124..177 CDD:295319 21/61 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1214165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.