DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mlp84B and zgc:101840

Sequence 1:NP_001303418.1 Gene:Mlp84B FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001005968.1 Gene:zgc:101840 ZFINID:ZDB-GENE-041010-43 Length:202 Species:Danio rerio

Alignment Length:202 Identity:76/203 (37%)
Similarity:101/203 (50%) Gaps:24/203 (12%)


  Fly     9 APKCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYC-KTCHGRKFGPKG 72
            |.|||:|.|:||:||:..:.|..:||.|.||..|||:|:.....||:.:.|| |.|:...:||||
Zfish     2 ASKCPKCEKTVYSAEKVTSLGKDWHKFCLKCERCNKTLNPGGHAEHDGKPYCHKPCYAALYGPKG 66

  Fly    73 YGFGTGAGTLSMDNGSQFLRENGD--VP-SVRNGARLEPRAIARAP---------EGEG--CPRC 123
            ...| |||:...|.      ..||  || ::....:.|.:...|.|         .||.  ||||
Zfish    67 VNIG-GAGSYVYDT------PVGDDSVPVAMETKPKTEEKKATRGPVKAASFSSFSGEPNICPRC 124

  Fly   124 GGYVYAAEQMLARGRSWHKECFKCGTCKKGLDSILCCEAPDKNIYC-KGCYAKKFGPKGYGYGQG 187
            ...||.||::.:.|:.||:.|.:|..|.|.|.:....| .|...|| |.|||..|||||...|..
Zfish   125 NKTVYFAEKVSSLGKDWHRPCLRCERCSKTLAAGSHAE-HDGQPYCHKPCYAVLFGPKGVNTGGV 188

  Fly   188 GGALQSD 194
            |..:..|
Zfish   189 GSYIYED 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 25/54 (46%)
LIM_CRP_like 120..173 CDD:188712 22/54 (41%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
zgc:101840NP_001005968.1 LIM1_TLP 5..58 CDD:188860 24/53 (45%)
LIM1_TLP 121..174 CDD:188860 22/54 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1214165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.