| Sequence 1: | NP_001303418.1 | Gene: | Mlp84B / 40849 | FlyBaseID: | FBgn0014863 | Length: | 495 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001005968.1 | Gene: | crip2l / 449795 | ZFINID: | ZDB-GENE-041010-43 | Length: | 202 | Species: | Danio rerio |
| Alignment Length: | 202 | Identity: | 76/202 - (37%) |
|---|---|---|---|
| Similarity: | 101/202 - (50%) | Gaps: | 24/202 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 APKCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYC-KTCHGRKFGPKG 72
Fly 73 YGFGTGAGTLSMDNGSQFLRENGD--VP-SVRNGARLEPRAIARAP---------EGEG--CPRC 123
Fly 124 GGYVYAAEQMLARGRSWHKECFKCGTCKKGLDSILCCEAPDKNIYC-KGCYAKKFGPKGYGYGQG 187
Fly 188 GGALQSD 194 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Mlp84B | NP_001303418.1 | LIM1_MLP84B_like | 11..64 | CDD:188788 | 24/53 (45%) |
| LIM_CRP_like | 120..173 | CDD:188712 | 21/53 (40%) | ||
| LIM_CRP_like | 222..275 | CDD:188712 | |||
| LIM_CRP_like | 325..378 | CDD:188712 | |||
| LIM_CRP_like | 421..474 | CDD:188712 | |||
| crip2l | NP_001005968.1 | LIM1_TLP | 5..58 | CDD:188860 | 23/52 (44%) |
| LIM1_TLP | 121..174 | CDD:188860 | 21/53 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1700 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1214165at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000284 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X318 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.820 | |||||