DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and Csrp2

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_031818.3 Gene:Csrp2 / 13008 MGIID:1202907 Length:193 Species:Mus musculus


Alignment Length:186 Identity:93/186 - (50%)
Similarity:116/186 - (62%) Gaps:10/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75
            ||..||::||.|||....|..||:.||.|.:|.|:||||....|:.|:|||:|:|:|:||||||:
Mouse     9 KCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGY 73

  Fly    76 GTGAGTLSMDNGSQFLRENGDVPSVRNGAR--LEPRAIARAPE---GEGCPRCGGYVYAAEQMLA 135
            |.|||||:||.|.:.    |..|......|  ..|.....|.:   .|.|.|||..|||||:::.
Mouse    74 GQGAGTLNMDRGERL----GIKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIG 134

  Fly   136 RGRSWHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYGQGGGAL 191
            .|:.|||.||:|..|.|.|:|....| .:..|||||||||.|||||:|||||.|||
Mouse   135 AGKPWHKNCFRCAKCGKSLESTTLTE-KEGEIYCKGCYAKNFGPKGFGYGQGAGAL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 26/52 (50%)
LIM_CRP_like 120..173 CDD:188712 26/52 (50%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Csrp2NP_031818.3 LIM1_CRP2 9..63 CDD:188864 27/53 (51%)
Nuclear localization signal. /evidence=ECO:0000255 64..69 2/4 (50%)
LIM2_CRP2 119..172 CDD:188871 27/53 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832345
Domainoid 1 1.000 79 1.000 Domainoid score I8633
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H111061
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 1 1.000 - - otm42781
orthoMCL 1 0.900 - - OOG6_104400
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.610

Return to query results.
Submit another query.