DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mlp84B and Csrp2

Sequence 1:NP_001303418.1 Gene:Mlp84B FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_031818.3 Gene:Csrp2 MGIID:1202907 Length:193 Species:Mus musculus

Alignment Length:186 Identity:93/187 (50%)
Similarity:116/187 (62%) Gaps:10/187 (5%)


  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75
            ||..||::||.|||....|..||:.||.|.:|.|:||||....|:.|:|||:|:|:|:||||||:
Mouse     9 KCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGY 73

  Fly    76 GTGAGTLSMDNGSQFLRENGDVPSVRNGAR--LEPRAIARAPE---GEGCPRCGGYVYAAEQMLA 135
            |.|||||:||.|.:.    |..|......|  ..|.....|.:   .|.|.|||..|||||:::.
Mouse    74 GQGAGTLNMDRGERL----GIKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIG 134

  Fly   136 RGRSWHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYGQGGGAL 191
            .|:.|||.||:|..|.|.|:|....| .:..|||||||||.|||||:|||||.|||
Mouse   135 AGKPWHKNCFRCAKCGKSLESTTLTE-KEGEIYCKGCYAKNFGPKGFGYGQGAGAL 189

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 27/53 (51%)
LIM_CRP_like 120..173 CDD:188712 27/53 (51%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Csrp2NP_031818.3 LIM1_CRP2 9..63 CDD:188864 27/54 (50%)
Nuclear localization signal. {ECO:0000255} 64..69 3/5 (60%)
LIM2_CRP2 119..172 CDD:188871 28/54 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H111061
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1214165at2759
OrthoFinder 1 1.000 FOG0000884
OrthoInspector 1 1.000 T615907
orthoMCL 1 0.900 OOG5_128738
Panther 1 1.100 O PTHR24215
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.780

Return to query results.
Submit another query.