DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tailor and TUT7

Sequence 1:NP_001262327.1 Gene:Tailor FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:XP_011517313.1 Gene:TUT7 HGNCID:25817 Length:1551 Species:Homo sapiens

Alignment Length:421 Identity:111/422 (26%)
Similarity:178/422 (42%) Gaps:100/422 (24%)


  Fly   145 TFSCSSCSNRIVGTTIAKAVAHLSEQHPKPNPNNQPVQPHPTHQTKQEKKQAQVKARQHITVRLP 209
            |..||.|          |...||.:..|                  ::.|:.|::....:|   |
Human   962 TVVCSLC----------KREGHLKKDCP------------------EDFKRIQLEPLPPLT---P 995

  Fly   210 KKARAMIVGEI-TNVFKDKYP--IADKLKVIPEYDVIEQDLCKLLSPGFPKQPLRVYKFGSRITG 271
            |...  |:.:: ...:||..|  |.|:.:     :.|.|:|...:...||...|.:  |||...|
Human   996 KFLN--ILDQVCIQCYKDFSPTIIEDQAR-----EHIRQNLESFIRQDFPGTKLSL--FGSSKNG 1051

  Fly   272 IGNRSSDLDLFVDIGKSGNTFHTFEHRASNATVAKL-RAMRKFFCDSEDWRLINFIEQARVPIIK 335
            .|.:.||||:.:.|    |...|.|......|:.:| |.:||    ....|.|..|..|:|||:|
Human  1052 FGFKQSDLDVCMTI----NGLETAEGLDCVRTIEELARVLRK----HSGLRNILPITTAKVPIVK 1108

  Fly   336 TCHLPTGIECDICL-NSMGFCNTNLLKYIFESQPLTQYMCIYVKNWLERCKLTE----QISTYSI 395
            ..||.:|:|.||.| |::...||.||.......|..:|:|..:|.:.:.|.:.:    .:|:|:.
Human  1109 FFHLRSGLEVDISLYNTLALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAY 1173

  Fly   396 TLMVIYFLQLQALLPPIAMLQ--IEDAANQAVLVGPWVVNFAQK------SFSELGLQQLKATVP 452
            ||||:|||| |...|.|.:||  .:......:.|..|.:.|..:      .:||.| :..::...
Human  1174 TLMVLYFLQ-QRNPPVIPVLQEIYKGEKKPEIFVDGWNIYFFDQIDELPTYWSECG-KNTESVGQ 1236

  Fly   453 VIKGFLRNFFAYFAKFDY-EHFLVCPYIGQANVEIAKIER--MLHARYSAYVSDNPECSIQLKKP 514
            :..|.||   .|..:||: ||             :..|.|  :|......:.|          |.
Human  1237 LWLGLLR---FYTEEFDFKEH-------------VISIRRKSLLTTFKKQWTS----------KY 1275

  Fly   515 MVVQDPIQLNHN----VTKAVTKYGLQTFVD 541
            :|::||..||||    :::.:|.:.::.|::
Human  1276 IVIEDPFDLNHNLGAGLSRKMTNFIMKAFIN 1306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 43/121 (36%)
TUT7XP_011517313.1 NT_PAP_TUTase 315..427 CDD:143392
PAP_assoc 550..599 CDD:281779
NT_PAP_TUTase 1021..1138 CDD:143392 44/132 (33%)
PAP_assoc 1233..1286 CDD:281779 18/79 (23%)
TUTF7_u4 1371..1450 CDD:293237
ZnF_C2HC 1452..1468 CDD:197667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12271
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.