DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tailor and tut7

Sequence 1:NP_001262327.1 Gene:Tailor FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:XP_021332039.1 Gene:tut7 ZFINID:ZDB-GENE-101209-1 Length:1155 Species:Danio rerio

Alignment Length:497 Identity:98/498 (20%)
Similarity:185/498 (37%) Gaps:139/498 (28%)


  Fly   107 GIESYLDRNPTYVLPQ--------EMAAPGEGVAFVQPQELQTIKRTFSCSSCSNRIVGTTIAKA 163
            |.:|:.|::...::..        ::....|| :...|:| .::...|.|..|  ::....|:.|
Zfish    95 GAQSWRDKSRFVLIDSCLTRRDVLQLCLEAEG-SDCDPKE-SSVSLKFRCDKC--KVFCEDISPA 155

  Fly   164 VAHLSEQHPKPNPNNQPVQPHPTHQTKQEKKQAQVKARQHITVRLPKKARAMIVGEITNVFKDKY 228
            ::|:.|:               :|:.|.::.|   |....:::..|.|...:.|.....      
Zfish   156 LSHIRER---------------SHRKKAKELQ---KLALLLSIPPPAKPHCLSVSSALE------ 196

  Fly   229 PIADKLKVIPEYDVIEQDLC----------KLLSPGFPKQPLRVYKFGSRITGIGNRSSDLDLFV 283
                  .::.|:.:.::||.          |:|.|..|:...|:|  ||..|..|.:.||:::.|
Zfish   197 ------SIVTEFGLNDEDLKQRQNILALIEKVLHPVLPECQFRLY--GSSSTKFGFKDSDVNIDV 253

  Fly   284 DIGKSGNTFHTFEHRASNATVAKLRAMRKFFCDSEDWRLINFIE---QARVPIIKTCHLPTGIEC 345
            .....      |:|...      |.|.::....|.   |.:.:|   ..|:|::......:|:.|
Zfish   254 KFPSH------FQHPDI------LLAAQEHLSKSS---LFDSVEGDFHRRMPVVVCKEKASGLIC 303

  Fly   346 DICLNSMGFC-NTNLLKYIFESQPLTQYMCIYVKNWLERCKLTEQ----ISTYSITLMVIYFLQ- 404
            .:...:...| .|..|..:.:.:|....:.|..:.|.:.|.:.:.    :.:|...||||.||| 
Zfish   304 KVSAGNESACLTTAYLSEMADLEPQLVPLVICFRYWAKICCVDQMEEGGLPSYCFALMVISFLQR 368

  Fly   405 -LQALLP--------PIAMLQ---IEDAANQAVLVGPWVVNFAQKSFSELGLQQ----------L 447
             .:.:||        |::.|:   :.......||   ||  :.|.:.|.|...:          .
Zfish   369 RKEPILPTYLESMGFPLSKLKSFSLTGVEKGHVL---WV--YDQTNDSSLDKDKAVKKGKAPLAF 428

  Fly   448 KATVPVIKGFL-RNFFAYFAKFDYEHFLVCPYIGQANVEIAKIERMLHARYSAY----VSDNPEC 507
            |:..||:.|.| .....|:|                 :|....|:::..|.:..    :.|.|  
Zfish   429 KSRSPVLLGKLWIELLRYYA-----------------LEFQIPEKIISVRTNGELWRDLKDWP-- 474

  Fly   508 SIQLKKPMVVQDPIQLNHNVTKAVTKYGLQTFVDY---CQQT 546
                ||.:.::||..:..||.:.:..   ||..||   |.:|
Zfish   475 ----KKRIAIEDPFTVQRNVARTLNS---QTMFDYLLHCLKT 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551 3/27 (11%)
NT_PAP_TUTase 245..364 CDD:143392 29/133 (22%)
tut7XP_021332039.1 PAP_assoc 150..>499 CDD:332051 84/427 (20%)
NT_PAP_TUTase 211..323 CDD:143392 27/129 (21%)
NT_PAP_TUTase 733..838 CDD:143392
PAP_assoc 902..955 CDD:309089
AIR1 <1009..1088 CDD:331526
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12271
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.