DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tailor and tent2

Sequence 1:NP_001262327.1 Gene:Tailor FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001018436.1 Gene:tent2 ZFINID:ZDB-GENE-050522-536 Length:489 Species:Danio rerio

Alignment Length:549 Identity:128/550 (23%)
Similarity:211/550 (38%) Gaps:170/550 (31%)


  Fly    59 MMPNKLLYMNPLTMEAHFFLQTLNSVNQTTNPPQLDPHLANLLERIMVGIESYLDRNPTYVLPQE 123
            |:|...::.:.....:|.|...|             ||..:..:|    ||::|:....::.| .
Zfish     1 MLPRPYIFSHNDGPSSHLFQHVL-------------PHNVSQQQR----IEAHLNSTNNFIGP-P 47

  Fly   124 MAAPGEGVAFV-----QPQELQTIKRTFSCSSCSNRIVGTTIAKAVAHLSEQHPK------PNPN 177
            |.||    .|:     .|.||..:    :||  .|..:|....:.:...|:.:.|      |:|:
Zfish    48 MNAP----RFIPTYQWTPVELSDV----ACS--PNGPMGNNRKRRIQDNSDINLKRQRFSCPSPH 102

  Fly   178 NQPV-------QPHPTHQTKQEKKQAQVKARQHITVRLPKKARAMIV--------GEI--TNVFK 225
            ||..       ||.....|.:|             |..|..:.|..:        ||.  .|.|.
Zfish   103 NQSARNSNFTSQPVTRPVTGRE-------------VTCPTCSSATFIPGGCVPSLGETCHQNAFS 154

  Fly   226 DKYPIADKL--KVIPEYDVIEQ-----------------DLCKLLSPGFPKQPLRVYKFGSRITG 271
            .. .:.|||  :::..:...||                 |:.|:    ||  ..:|:..||.:.|
Zfish   155 PS-SVKDKLSQQILNLFFACEQQSDDLEKKESCRAALQTDIQKI----FP--CAKVFLGGSSLNG 212

  Fly   272 IGNRSSDLDLFVDIGKSGNTFHTFEHRASNATVAKLRAMRKFFCDSEDWRLINFIE-----QARV 331
            .|:||||.||.:.|.:.     ...||.....|..|  :||....      :::||     :|:|
Zfish   213 FGSRSSDADLCLVIEEG-----PVNHRKDAVYVLSL--VRKLLYK------LSYIEKPQLIRAKV 264

  Fly   332 PIIKTCHLPTGIECDICL-NSMGFCNTNLLK-YIF---ESQPLTQYMCIYVKNWLERCKLTE--- 388
            ||:|.....:|:|.|:.. |::|..||.||: |.|   ..:||.    :.:|.|.....:.:   
Zfish   265 PIVKFRDRISGVEFDLNFNNTVGIRNTFLLRTYAFVEKRVRPLV----LVIKKWANHHCINDASR 325

  Fly   389 -QISTYSITLMVIYFLQLQALLPPIAMLQIE-----DAANQAVLV--GPW-VVNFAQKSFSELGL 444
             .:|:|::.|||:::||... .|.|..||.:     |......||  ||. :..|..::.|.|| 
Zfish   326 GTLSSYTLVLMVLHYLQTLP-EPVIPCLQRDYPTCFDPKMDIHLVPSGPSDIPAFVSRNQSSLG- 388

  Fly   445 QQLKATVPVIKGFLRNFFAYFAKFD-------------------YEHFLVC---PYIGQANVEIA 487
                   .:..|||| ::|...|:|                   ::...:|   |: .:.|...|
Zfish   389 -------DLFLGFLR-YYATVFKWDKQVISVRMARTLPKSNCKEWKDKFICVEEPF-NRTNTARA 444

  Fly   488 KIERM-LHARYSAYVSDNPECSIQLKKPM 515
            ..||| ..|..:|::..:.  .:||:|.:
Zfish   445 VHERMKFEAIKAAFIESHR--LLQLRKDL 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551 11/56 (20%)
NT_PAP_TUTase 245..364 CDD:143392 40/143 (28%)
tent2NP_001018436.1 NT_PAP_TUTase 182..298 CDD:143392 39/135 (29%)
PAP_assoc 386..440 CDD:281779 11/64 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.