DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tailor and Tut7

Sequence 1:NP_001262327.1 Gene:Tailor FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:XP_006222382.1 Gene:Tut7 RGDID:1586015 Length:1550 Species:Rattus norvegicus

Alignment Length:469 Identity:120/470 (26%)
Similarity:195/470 (41%) Gaps:114/470 (24%)


  Fly   101 LERIMVGIESYLDRNPTYVLPQEMAAPGEGVAFVQPQELQTIKR----TFSCSSCSNRIVGTTIA 161
            |.||.:..||:.:.|          :||:...|.......|..:    |..||.|          
  Rat   928 LNRITLKEESFFEEN----------SPGDQSEFFYEFRKLTFTKGKSPTVVCSLC---------- 972

  Fly   162 KAVAHLSEQHPKPNPNNQPVQPHPTHQTKQEKKQAQVKARQHITVRLPKKARAMIVGEI-TNVFK 225
            |...||.:..|                  ::.|:.|::....:|   ||.:.  |:.:: ...:|
  Rat   973 KREGHLKKDCP------------------EDFKRIQLEPLPPLT---PKFSN--ILDQVCIQCYK 1014

  Fly   226 DKYP--IADKLKVIPEYDVIEQDLCKLLSPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGKS 288
            |..|  :.|:.:     :.|.|:|...:...||...|.:  |||...|.|.:.||||:.:.|   
  Rat  1015 DFSPTIVEDQAR-----EHIRQNLESFIKQDFPGTKLSL--FGSSKNGFGFKQSDLDVCMTI--- 1069

  Fly   289 GNTFHTFEHRASNATVAKL-RAMRKFFCDSEDWRLINFIEQARVPIIKTCHLPTGIECDICL-NS 351
             |...|.|......|:.:| |.:||    ....|.|..|..|:|||:|..||.:|:|.||.| |:
  Rat  1070 -NGHETAEGLDCVRTIEELARVLRK----HSGLRNILPITTAKVPIVKFSHLRSGLEVDISLYNT 1129

  Fly   352 MGFCNTNLLKYIFESQPLTQYMCIYVKNWLERCKLTE----QISTYSITLMVIYFLQLQALLPPI 412
            :...||.||.......|..:|:|..:|.:.:.|.:.:    .:|:|:.||||:|||| |...|.|
  Rat  1130 LALHNTRLLFAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQ-QRSPPVI 1193

  Fly   413 AMLQ--IEDAANQAVLVGPWVVNFAQK------SFSELGLQQLKATVPVIKGFLRNFFAYFAKFD 469
            .:||  .:......:||..|.:.|..:      .:.|.| :..::...:..|.||   .|..:||
  Rat  1194 PVLQEIYKGEKKPEILVDGWNIYFFDQINELPTCWPEYG-KNTESVGQLWLGLLR---FYTEEFD 1254

  Fly   470 Y-EHFLVCPYIGQANVEIAKIER--MLHARYSAYVSDNPECSIQLKKPMVVQDPIQLNHN----V 527
            : ||             :..|.|  :|......:.|          |.:|::||..||||    :
  Rat  1255 FKEH-------------VISIRRKSLLTTFKKQWTS----------KYIVIEDPFDLNHNLGAGL 1296

  Fly   528 TKAVTKYGLQTFVD 541
            ::.:|.:.::.|::
  Rat  1297 SRKMTNFIMKAFIN 1310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551 6/25 (24%)
NT_PAP_TUTase 245..364 CDD:143392 43/121 (36%)
Tut7XP_006222382.1 NT_PAP_TUTase 315..427 CDD:143392
PAP_assoc 550..599 CDD:281779
NT_PAP_TUTase 1025..1142 CDD:143392 44/132 (33%)
PAP_assoc 1237..1290 CDD:281779 18/79 (23%)
TUTF7_u4 1372..1451 CDD:293237
ZnF_C2HC 1453..1469 CDD:197667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12271
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.