DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tailor and Tent2

Sequence 1:NP_001262327.1 Gene:Tailor FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001008373.1 Gene:Tent2 RGDID:1306438 Length:484 Species:Rattus norvegicus

Alignment Length:358 Identity:86/359 (24%)
Similarity:154/359 (43%) Gaps:91/359 (25%)


  Fly   206 VRLPKKARAMIVGEITNVFKDKYPIADKLKVIPEYDVIEQDLCK--------LLSPGFPKQPLRV 262
            :.|| :|:..:..:|..:|:.....|..||        :::||:        ||   ||:.  |:
  Rat   147 ITLP-EAKDKLSQQILELFETCQQQASDLK--------KKELCRAQLQREIQLL---FPQS--RL 197

  Fly   263 YKFGSRITGIGNRSSDLDLFVDIGKSGNTFHTFEHRASNATVAK--LRAMRKFFCDSEDWRLINF 325
            :..||.:.|.|.||||.||.:.:.:....|     :.:..|.|:  |..:.|.||.    ||..:
  Rat   198 FLVGSSLNGFGARSSDGDLCLVVKEEPCFF-----QVNQKTEARHILTLVHKHFCT----RLSGY 253

  Fly   326 IE-----QARVPIIKTCHLPTGIECDICL-NSMGFCNTNLLKYIFESQPLTQYMCIYVKNWLERC 384
            ||     :|:|||:|.....:.:|.|:.: |::|..||.||:.....:...:.:.:.:|.|....
  Rat   254 IERPQLIRAKVPIVKFRDKVSCVEFDLNVNNTVGIRNTFLLRTYAYLENRVRPLVLVIKKWASHH 318

  Fly   385 KLTE----QISTYSITLMVIYFLQL--QALLPPIAMLQIEDAANQAVL---------VGPWVVNF 434
            ::.:    .:|:||:.|||:::||.  :.:||.:..:..|..:....|         |.|::   
  Rat   319 EINDASRGTLSSYSLVLMVLHYLQTLPEPILPSLQKIYPESFSTSVQLHLVHHAPCNVPPYL--- 380

  Fly   435 AQKSFSELGLQQLKATVPVIKGFLRNFFAYFA-KFDYEHFLVCPYIGQANVEIAKIERMLHARYS 498
             .|:.|.||        .::.|||:    |:| :||:.                  .:|:..| .
  Rat   381 -SKNESSLG--------DLLLGFLK----YYATEFDWN------------------TQMISVR-E 413

  Fly   499 AYVSDNPECSIQLKKPMVVQDPIQLNHNVTKAV 531
            |.....|:......|.:.|::|.. ..|..:||
  Rat   414 AKAIPRPDDMEWRNKYICVEEPFD-GTNTARAV 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 41/135 (30%)
Tent2NP_001008373.1 Nuclear localization signal. {ECO:0000255} 76..92
NT_PAP_TUTase 176..298 CDD:143392 41/136 (30%)
PAP_assoc 386..440 CDD:281779 16/86 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.