DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tailor and Mtpap

Sequence 1:NP_001262327.1 Gene:Tailor FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:XP_006254133.1 Gene:Mtpap RGDID:1310900 Length:602 Species:Rattus norvegicus

Alignment Length:620 Identity:122/621 (20%)
Similarity:229/621 (37%) Gaps:207/621 (33%)


  Fly    30 RKTSLPGSTAPNIAAPVTKATK---------------KNKTMAEMM------------------- 60
            |::.:|.|.:.:::.|.|:...               ::||:.:..                   
  Rat    36 RRSRVPHSISRHLSCPGTRVASVGSEEQPSGGAETGTEDKTLQKKFSEVQKERREQAQRTVLIHC 100

  Fly    61 PNK------LLYMNPL-TMEAHFFLQ--------------TLNSVNQTTNPPQLDPHLANLLERI 104
            ||.      |.|::.. ::..|||.:              ::||:...|:.|......|...:..
  Rat   101 PNNINEKKFLKYLSQHGSISNHFFYESFGLYAVVEFCQKDSINSLQNGTHTPTQSTEAAIPFKSR 165

  Fly   105 MVGIESYLDRNPTYVLPQEMAAPGEGVAFVQ--PQELQTIKRTFSCSSCSNRIVG--TTIAKAVA 165
            .:.::.   :||:..:        .|.:|||  .|...:.|:.|...|.:..|..  |.:.||. 
  Rat   166 FLNLKL---KNPSNQV--------SGQSFVQADSQSPPSSKKLFELLSYAESIDAQLTALLKAF- 218

  Fly   166 HLSEQHPKPNPNNQPVQPHPTHQTKQEKKQAQVKARQHITVRLPKKARAMIVGEITNVFKDKYPI 230
            .|:|::                          |:.| |:|..|        :.:|...:      
  Rat   219 QLTEEN--------------------------VRLR-HLTCSL--------IEDIAAAY------ 242

  Fly   231 ADKLKVIPEYDVIEQDLCKLLSPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGKSGN-TFH- 293
                                    ||.  ..|:.|||.:...|....|||:|:|:.::|| :.| 
  Rat   243 ------------------------FPS--CVVWPFGSSVNTFGKLGCDLDMFLDLDETGNLSDHK 281

  Fly   294 -----TFEHRASNATVAKLRAMRKFFCDSEDWRLINF---------IEQARVPIIKTCHLPTGIE 344
                 ..|.:..|....::...:......|  .|.||         |..||.|:::..|..:|.:
  Rat   282 NTGNFLMEFQVKNVPSERVATQKILSVIGE--CLDNFGPGCVGVQKILNARCPLVRFSHQGSGFQ 344

  Fly   345 CDICLNSMGFCNTNLLKYIFES-QPLTQYMCIYVKNWLERCKLTEQ-----ISTYSITLMVIYFL 403
            ||:..|:.....::.|.||:.| ....:.:...|:.|.....||..     |:.:|:|:|||:||
  Rat   345 CDLTANNSIALKSSELLYIYGSLDSRVRALVFGVRCWARAHSLTSSIPGAWITNFSLTMMVIFFL 409

  Fly   404 QLQALLPPI-----AMLQIEDAANQAVLVGPWVVNFAQKSFSELGLQQLK--ATVPVIKGFLRNF 461
            |.::  |||     ::..:.||.::.:|.|. ...|.|      .:.::|  .....::..|:.|
  Rat   410 QRRS--PPILPTLDSLKSMADAEDRCILEGN-NCTFIQ------DINKIKPSGNTETLELLLKEF 465

  Fly   462 FAYFAKFDYEHFLVCPYIGQANVEIAKIERMLHARYSAYVSDNPECSIQLKKPMVVQDPIQLNHN 526
            |.||..|.:..       ...|:...:.:            :.|:.|     |:.:|:|.:.:.|
  Rat   466 FEYFGNFAFNK-------NSINIRQGREQ------------NKPDSS-----PLYIQNPFETSLN 506

  Fly   527 VTKAVTKYGLQTFVDYCQQTAELLE-----EPSTN 556
            ::|.|::..||.||:..:.:|.:||     :||::
  Rat   507 ISKNVSQNQLQKFVELARDSAWILEQEKKDQPSSS 541

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551 10/71 (14%)
NT_PAP_TUTase 245..364 CDD:143392 33/135 (24%)
MtpapXP_006254133.1 NT_PAP_TUTase 227..365 CDD:143392 38/181 (21%)
PAP_assoc 461..504 CDD:281779 12/67 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1188122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.