DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tailor and cid1

Sequence 1:NP_001262327.1 Gene:Tailor FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_594901.1 Gene:cid1 PomBaseID:SPAC19D5.03 Length:405 Species:Schizosaccharomyces pombe

Alignment Length:390 Identity:90/391 (23%)
Similarity:161/391 (41%) Gaps:103/391 (26%)


  Fly   192 EKKQAQVKARQHIT-----VRLPKKARAM------IVGEI---TNVFKDKYPIADKLKVIPEYDV 242
            |:.:|::....||:     .::|...:..      :..||   ...||:|....|.|:       
pombe    16 EEIEAEIHKNLHISKSCSYQKVPNSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLR------- 73

  Fly   243 IEQDLC-KLLSPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGKSGNTFHTFEHRASNATVAK 306
                || |.:||     ...:..|||..:|:..::||:||.|          ..:.|..:.|:| 
pombe    74 ----LCLKRISP-----DAELVAFGSLESGLALKNSDMDLCV----------LMDSRVQSDTIA- 118

  Fly   307 LRAMRKFFCDSEDWRLINFIEQARVPIIK-TCHLPTG----IECDICLNS-MGFCNTNLLKYIFE 365
            |:...:...:..:.:   |:::||:|||| |.....|    .:|||..|: :...||.||....:
pombe   119 LQFYEELIAEGFEGK---FLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTK 180

  Fly   366 SQPLTQYMCIYVKNWLERCKLTE----QISTYSITLMVIYFLQLQALLPPIAMLQIEDAANQAVL 426
            .....:.|.:.||:|.:|.::..    .:|:|...|||:|:| :..:.||:....:.....|..:
pombe   181 LDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYL-IHVIKPPVFPNLLLSPLKQEKI 244

  Fly   427 VGPWVVNFAQK--------SFSELGLQQLKATVPVIKGFLRNFFAYFAKFDYEHFLVC-----PY 478
            |..:.|.|..|        ::|.||        .::.||.| |:||  ||:....:|.     .|
pombe   245 VDGFDVGFDDKLEDIPPSQNYSSLG--------SLLHGFFR-FYAY--KFEPREKVVTFRRPDGY 298

  Fly   479 IGQ-------ANVEIAKIERMLHARYSAYVSDNPECSIQLKKPMVVQDPIQLNHNVTKAVTKYGL 536
            :.:       |.......::::..||.                :.::||.:::|||.:.|:..||
pombe   299 LTKQEKGWTSATEHTGSADQIIKDRYI----------------LAIEDPFEISHNVGRTVSSSGL 347

  Fly   537  536
            pombe   348  347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 35/126 (28%)
cid1NP_594901.1 TRF4 1..405 CDD:227585 90/391 (23%)
NT_PAP_TUTase 65..178 CDD:143392 38/143 (27%)
PAP_assoc 267..336 CDD:281779 17/96 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12271
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.