DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tailor and Tut7

Sequence 1:NP_001262327.1 Gene:Tailor FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:XP_011242810.1 Gene:Tut7 MGIID:2387179 Length:1545 Species:Mus musculus

Alignment Length:469 Identity:123/470 (26%)
Similarity:195/470 (41%) Gaps:114/470 (24%)


  Fly   101 LERIMVGIESYLDRNPTYVLPQEMAAPGEGVAFVQPQELQTIKR----TFSCSSCSNRIVGTTIA 161
            |.||.:..||:         |:| ..||:...|.......|..:    |..||.|          
Mouse   920 LNRITLKEESF---------PEE-DLPGDQSEFFYEFRKLTFTKGKSPTVVCSLC---------- 964

  Fly   162 KAVAHLSEQHPKPNPNNQPVQPHPTHQTKQEKKQAQVKARQHITVRLPKKARAMIVGEI-TNVFK 225
            |...||.:..|                  ::.|:.|::....:|   ||.:.  |:.:: ...:|
Mouse   965 KREGHLKKDCP------------------EDFKRVQLEPLPPLT---PKFSN--ILDQVCVQCYK 1006

  Fly   226 DKYP--IADKLKVIPEYDVIEQDLCKLLSPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGKS 288
            |..|  :.|:.:     :.|.|:|...:...||...|.:  |||...|.|.:.||||:.:.|   
Mouse  1007 DFSPTIVEDQAR-----EHIRQNLESFIKQDFPGTKLSL--FGSSKNGFGFKQSDLDVCMTI--- 1061

  Fly   289 GNTFHTFEHRASNATVAKL-RAMRKFFCDSEDWRLINFIEQARVPIIKTCHLPTGIECDICL-NS 351
             |...|.|......|:.:| |.:||    ....|.|..|..|:|||:|..||.:|:|.||.| |:
Mouse  1062 -NGHETAEGLDCVRTIEELARVLRK----HSGLRNILPITTAKVPIVKFFHLRSGLEVDISLYNT 1121

  Fly   352 MGFCNTNLLKYIFESQPLTQYMCIYVKNWLERCKLTE----QISTYSITLMVIYFLQLQALLPPI 412
            :...||.||.......|..:|:|..:|.:.:.|.:.:    .:|:|:.||||:|||| |...|.|
Mouse  1122 LALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQ-QRSPPVI 1185

  Fly   413 AMLQ--IEDAANQAVLVGPWVVNFAQK------SFSELGLQQLKATVPVIKGFLRNFFAYFAKFD 469
            .:||  .:......:||..|.:.|..:      .:.|.|    |.|.||.:.:|.....|..:||
Mouse  1186 PVLQEIYKGEKKPEILVDGWNIYFFDQINELPTCWPEYG----KNTEPVGQLWLGLLRFYTEEFD 1246

  Fly   470 Y-EHFLVCPYIGQANVEIAKIER--MLHARYSAYVSDNPECSIQLKKPMVVQDPIQLNHN----V 527
            : ||             :..|.|  :|......:.|          |.:|::||..||||    :
Mouse  1247 FKEH-------------VISIRRKSLLTTFKKQWTS----------KYIVIEDPFDLNHNLGAGL 1288

  Fly   528 TKAVTKYGLQTFVD 541
            ::.:|.:.::.|::
Mouse  1289 SRKMTNFIMKAFIN 1302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551 7/25 (28%)
NT_PAP_TUTase 245..364 CDD:143392 43/121 (36%)
Tut7XP_011242810.1 NT_PAP_TUTase 315..427 CDD:143392
PAP_assoc 550..599 CDD:281779
NT_PAP_TUTase 1017..1134 CDD:143392 44/132 (33%)
PAP_assoc 1229..1282 CDD:281779 18/76 (24%)
TUTF7_u4 1367..1446 CDD:293237
ZnF_C2HC 1448..1464 CDD:197667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12271
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.