DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ufl1 and AT3G46220

Sequence 1:NP_001246957.1 Gene:Ufl1 FlyBaseID:FBgn0037467 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001190020.1 Gene:AT3G46220 AraportID:AT3G46220 Length:812 Species:Arabidopsis thaliana

Alignment Length:844 Identity:212/845 (25%)
Similarity:384/845 (45%) Gaps:159/845 (19%)


  Fly     6 DEIKRLAADFQKAQLTSTLQKLSERNCVEIVTLLLEKQML--EVVFTNDGKEYITPDHLEREIQD 68
            ||:..|...|:.||...:..:||:||.||:|..|.|..::  :::.|..||||||.:.|..||..
plant     3 DELLELQRQFEFAQQVKSSVRLSDRNVVELVQKLQELGVIDFDLLHTVTGKEYITQEQLRNEITR 67

  Fly    69 ELYVNGGRANLVEVSKTLNVDLSRIELLAERISAENQSVHLVLGQLIDEDYISHIAQEINEKLVQ 133
            |: ...||.::::::.|:.|||..:|..|:.:...:..:.||.|::|.:.|...||:||||:|.:
plant    68 EI-SKLGRVSVIDLADTIGVDLYHVEKQAQDVVLNDPGLMLVQGEIISQSYWDSIAEEINERLQE 131

  Fly   134 RGEVSISELASQFDLPSDFLQHDVVEKHLGKIIKGRQDASNPRVFFTQAYIQRCKAKIRGALAAI 198
            ..:::::|||.|..:.|:.:| .|:|..||.::|.|.:...   .:|.||::|..|.:|||...|
plant   132 CSQIAVAELAGQLQVGSELVQ-SVLEPRLGTLVKARLEGGQ---LYTPAYVERVTAMVRGASRGI 192

  Fly   199 TRPINVAVI---LQKIGVQE---------------KIFYSLLDEIAPAGQVTSKQANSQYVPHIY 245
            ..|.|::.:   ||:: |||               .||..||.|....|   |.:|.:.:.|..:
plant   193 FVPSNLSALWAPLQQL-VQETNGASGVAVENSFFQSIFNRLLKEEEMLG---SLRAGTHWTPSAF 253

  Fly   246 AKTQADWVNSFYKQNSFLEYDAIQKLGISDAKSYIRKQFPNEEFLYLKRVALGARLVELTVVTAL 310
            |..|.:.|:|.:.|||::.|:::||||||.|..:::.::|  :...|..|.:.:.::|: :.:|.
plant   254 ATAQKECVDSSFSQNSYISYESMQKLGISQAVQFLQSRYP--DGTPLAAVFIHSSMIEM-LDSAT 315

  Fly   311 NECSATKQYLDLTTILPSNLSEEDIEE-------VFSTIMAQKHSNPSNFVYLDGIVFSQPYLAQ 368
            .:......::|..::|||:.:.:|..:       |.|.:.|:|           .::..:.|:  
plant   316 EDAIEQNSWIDSLSVLPSSFTSQDANKMLLLCPSVQSALKAEK-----------ALILGESYV-- 367

  Fly   369 LVQPCQALAESQAKAAIDGGVYQQYIVEK------------TLAQKGNVSTQELED-EGKVDKRD 420
                   |:....|     |:|.|  :||            ||....:.|::..|. ....||..
plant   368 -------LSSGFIK-----GIYDQ--IEKEADAFSIQASTATLIHPSSKSSESTESIPANTDKGS 418

  Fly   421 ERRKKASSGKAGGGAQGRETKTKSTKKHQRGKAAAQFDSDDEDDAQQGSR--------------- 470
            :::|            |:...||:        |..:...|||:||:..|:               
plant   419 KKKK------------GKSASTKA--------ATVETVPDDEEDARPKSKRNQKKGRDSSSSQKL 463

  Fly   471 ----GGGGASKKAVKPLELVKTAD-IVKLITASL---EEEG---------------LEHLSKSIA 512
                ||...|.||.:...::...: ::|.|..|:   |::|               |:||:..:.
plant   464 DSKAGGKKESVKAQESNNIIPPDEWVMKKIVDSVPEFEDDGTSENFFLCTENPDSILKHLADHMK 528

  Fly   513 SLYTNQFNQTALARAQELFEATPQTNRRQTHAAIQDRINTLLIDIRLYEKGLKLFPQDTQTQLV- 576
            .:..|...:    |.:::|.......||... .:|.:::...::::||||.|.||..|..|.:| 
plant   529 PMLINSLKE----RRKKIFTENADRMRRLID-DLQKKLDESFLNMQLYEKALDLFEDDQSTAVVL 588

  Fly   577 -KYLLKSL----------GNEICNELSLYVASECNLTVKNTNLNVDQRNKLAQECEAQYRAALLE 630
             ::||::.          |.:|.|::......|.:.|.....|:..:|..||:..........|.
plant   589 HRHLLRTTAATIADTLLHGLDIHNKMKNGTEVEESKTQDLVLLDSSERTALAKNLNGSLSKKALA 653

  Fly   631 QNKAL-NKSIDDFELATETVLKTCSMIIKKVDKKKDRLLIADHKKKLQKQLLECNEPALLLHLAA 694
            ..:|| .|.:|.|.:....:.:...:::||:|||.:|.|:..::|.|..|:...::|..||....
plant   654 LVEALEGKRVDTFMVTFRDLAEESGLVLKKLDKKLERTLLHSYRKDLISQVSTESDPIALLAKVV 718

  Fly   695 LILFTTITGSILHASGKFVSAILQHIRGSLNEDQNALLLRYHDLVLQVLQAIPDSNESKLANEH 758
            .:||..|....|.|.|:.::|.:.|::..|:|.....|..|....:.:|..:..|:    ..||
plant   719 SLLFIKIHNKALQAPGRAIAAAISHLKEKLDESAYKTLTDYQTATVTLLALMSASS----GEEH 778

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ufl1NP_001246957.1 DUF2042 7..271 CDD:286786 92/284 (32%)
AT3G46220NP_001190020.1 PLN03083 1..809 CDD:215565 212/845 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H9093
Inparanoid 1 1.050 228 1.000 Inparanoid score I1124
OMA 1 1.010
OrthoDB 1 1.010 D289380at2759
OrthoInspector 1 1.000 T192516
orthoMCL 1 0.900 OOG5_130013
Panther 1 1.100 LDO PTHR31057
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.