DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ufl1 and Ufl1

Sequence 1:NP_001246957.1 Gene:Ufl1 FlyBaseID:FBgn0037467 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001342441.1 Gene:Ufl1 MGIID:1914740 Length:793 Species:Mus musculus

Alignment Length:826 Identity:295/827 (36%)
Similarity:472/827 (57%) Gaps:80/827 (10%)


  Fly     1 MGSDWDEIKRLAADFQKAQLTSTLQKLSERNCVEIVTLLLEKQMLEVVFTNDGKEYITPDHLERE 65
            |...|:||:|||||||:||...:.|:||||||:|||..|:.::.||||.|.||||||||..:.:|
Mouse     1 MADAWEEIRRLAADFQRAQFAESTQRLSERNCIEIVNKLISQKQLEVVHTLDGKEYITPAQISKE 65

  Fly    66 IQDELYVNGGRANLVEVSKTLNVDLSRIELLAERISAENQSVHLVLGQLIDEDYISHIAQEINEK 130
            ::|||:|.|||.|:|::.:.:||||:.||.....|....:.|.:||||||||:|:..:::|:|:|
Mouse    66 MRDELHVRGGRVNIVDLQQVINVDLTHIESRVSDIIKSEKHVQMVLGQLIDENYLDQLSEEVNDK 130

  Fly   131 LVQRGEVSISELASQFDLPSDFLQHDVVEKHLGKIIKGRQDASNPRVFFTQAYIQRCKAKIRGAL 195
            |.:.|:|::|||...:|||.|||...:.:: ||:||.|..|..|..|.||:|::.|.||:|||..
Mouse   131 LQESGQVTVSELCKAYDLPGDFLTQALTQR-LGRIINGHLDLDNRGVIFTEAFVARHKARIRGLF 194

  Fly   196 AAITRPINVAVILQKIGVQEKIFYSLLDEIAPAGQ-----VTSKQANSQYVPHIYAKTQADWVNS 255
            :|||||..|..::.|.|.||::.||:|:::...|:     |..:|..:.:||.||::||:.||:|
Mouse   195 SAITRPTPVNSLVSKYGFQEQLLYSVLEDLVSTGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDS 259

  Fly   256 FYKQNSFLEYDAIQKLGISDAKSYIRKQFPNEEFLYLKRVALGARLVELTVVTALNECSATKQYL 320
            |::||.:||:||:.:|||.||.:||:|::.|.:.|:||...:|..||: .|..::.|..::..::
Mouse   260 FFRQNGYLEFDALSRLGIPDAVNYIKKRYKNTQLLFLKATCVGQGLVD-QVEASVEEAISSGTWV 323

  Fly   321 DLTTILPSNLSEEDIEEVFSTIMAQKHSNPSNFVYLDGIVFSQPYLAQLVQPCQAL--------A 377
            |::.:|||:||.||...:...:|.......|..|:.|.:|.|:.::..    |..|        |
Mouse   324 DISPLLPSSLSVEDAAMLLQQVMRPFGKLASAIVFSDTVVVSEKFITD----CTGLFSERMHQKA 384

  Fly   378 ESQAKAAIDGGVYQQYIVEKTLAQKGNVSTQELEDEGKVDKRDERRKKASSG----KAGGGAQGR 438
            |.:.|   :..|:  .|.|:.|.|   :|..|..:..|.||:|||||||:.|    :.|||...|
Mouse   385 EKEMK---NNPVH--LITEEDLKQ---ISILESVNTSKKDKKDERRKKATEGSGSVRGGGGGNAR 441

  Fly   439 ETKTKSTKKHQRGKAAAQFDSDDEDDAQQGSRGGGGASKKAVKPLELVKTADIVKLITASLE--- 500
            |.|.|.|||..|       ..:|.||..|.|.||    ||  ||       ||..:....:|   
Mouse   442 EYKIKKTKKKGR-------KDEDSDDESQSSHGG----KK--KP-------DITFMFQDEIEDCL 486

  Fly   501 ----EEGLEHLSKSIASLYTNQFNQTALARAQELFEATPQ---TNRRQTHAAIQDRINTLLIDIR 558
                ::..|.....:|.......|:..|...:.:|.::..   |.|::|...:|:.::.|..:||
Mouse   487 RKHIQDAPEEFISELAEYLIKPLNKMYLEVVRSVFMSSTSASGTGRKRTIKDLQEEVSNLYNNIR 551

  Fly   559 LYEKGLKLFPQDTQTQLVKYLLKSLGNEICNELSLYVASECNLTVKN-TNLNVDQRNKLAQECEA 622
            |:|||:|.|..||||.|.|:|||::..:|.|.:..::||:..:.|:. ..:..|.|.|:..:...
Mouse   552 LFEKGMKYFADDTQTALTKHLLKTVCTDITNLMFNFLASDFLMAVEEPAAITSDIRKKILSKLTE 616

  Fly   623 QYRAALLEQNKALN-KSIDDFELATETVLKTCSMIIKKVDKKKDRLLIADHKKKLQKQLLECNEP 686
            :.:.||.:.:.:|| |||:||....::..:.|.:::||.|||::|.::..|::.|.:||....:|
Mouse   617 ETKVALTKLHNSLNEKSIEDFLSCLDSATEACDIMVKKGDKKRERQILFQHRQALCEQLKVTEDP 681

  Fly   687 ALLLHLAALILFTTITGSILHASGKFVSAILQHIRGSLNEDQNALLLRYHDLVLQVLQA------ 745
            ||:|||.|::||...|.|:|||.|:.|..|:..:...:.|||:.||::|..||::.|.:      
Mouse   682 ALILHLTAVLLFQLSTHSMLHAPGRCVPQIIAFLHSKIPEDQHTLLVKYQGLVVKQLVSQNKKTG 746

  Fly   746 ---IPDSNE--------SKLANEHLQTMQNQVVELAQNFSRASISK 780
               .|.|:|        :....:.||.:...:.:|.....::|:::
Mouse   747 QGEDPSSDELDKEQHDVTNATRKELQELSLSIKDLVLKSRKSSVTE 792

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ufl1NP_001246957.1 DUF2042 7..271 CDD:286786 126/269 (47%)
Ufl1NP_001342441.1 Required for E3 UFM1-protein ligase activity. {ECO:0000250|UniProtKB:O94874} 2..212 102/210 (49%)
Mediates interaction with DDRGK1. {ECO:0000250|UniProtKB:O94874} 2..200 98/198 (49%)
DUF2042 7..275 CDD:313039 129/273 (47%)
Involved in CDK5RAP3-binding. {ECO:0000250|UniProtKB:O94874} 121..250 54/134 (40%)
Mediates interaction with TRIP4. {ECO:0000250|UniProtKB:O94874} 200..400 69/213 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C311319292
eggNOG 1 0.900 E1_KOG2235
Hieranoid 1 1.000
Homologene 1 1.000 H9093
Inparanoid 1 1.050 488 1.000 Inparanoid score I1398
Isobase 1 0.950 0 Normalized mean entropy S6103
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006450
OrthoInspector 1 1.000 T1084273
orthoMCL 1 0.900 OOG5_130013
Panther 1 1.100 LDO PTHR31057
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2878
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.