DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ufl1 and ufl1

Sequence 1:NP_001246957.1 Gene:Ufl1 FlyBaseID:FBgn0037467 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_956900.1 Gene:ufl1 ZFINID:ZDB-GENE-040426-1163 Length:793 Species:Danio rerio

Alignment Length:812 Identity:290/813 (36%)
Similarity:468/813 (58%) Gaps:67/813 (8%)


  Fly     1 MGSDWDEIKRLAADFQKAQLTSTLQKLSERNCVEIVTLLLEKQMLEVVFTNDGKEYITPDHLERE 65
            |.:||:||:|||||||:||...|:|:||||||:|||:.|:|.:.|:||.|.|||||:||..:.||
Zfish     1 MAADWEEIRRLAADFQRAQFAETVQRLSERNCIEIVSKLVEDKKLDVVHTLDGKEYVTPAQISRE 65

  Fly    66 IQDELYVNGGRANLVEVSKTLNVDLSRIELLAERISAENQSVHLVLGQLIDEDYISHIAQEINEK 130
            |:||||::.||.|:|::.|.:||||..:|..|..|:..::...|:|||||||.|:..:|:|:|:|
Zfish    66 IRDELYMHRGRINVVDLQKIINVDLVHVEGRANEIAKSDRGTQLILGQLIDEAYLDRLAEEVNDK 130

  Fly   131 LVQRGEVSISELASQFDLPSDFLQHDVVEKHLGKIIKGRQDASNPRVFFTQAYIQRCKAKIRGAL 195
            |.:.|:|:|:||...:|||.|||. :.:...||::|:|:.|..|..:.||||::.|.||.|.|..
Zfish   131 LQEAGQVNIAELCKTYDLPGDFLT-EALNARLGRVIQGQLDQYNRGMIFTQAFLSRHKACICGLF 194

  Fly   196 AAITRPINVAVILQKIGVQEKIFYSLLDEIAPAGQ-----VTSKQANSQYVPHIYAKTQADWVNS 255
            :.||||..:..:|...|.||.:.||:|:|:..:.:     |..:|..:.|:|.||:|.|:.||.|
Zfish   195 SGITRPTQINNLLNLYGFQENLVYSMLEELVNSARLKGSVVGGRQDKAIYIPDIYSKAQSTWVES 259

  Fly   256 FYKQNSFLEYDAIQKLGISDAKSYIRKQFPNEEFLYLKRVALGARLV---ELTVVTALNECSATK 317
            |.|||.:||::::.:|||.|..:||:|:|.:...|:||...:|..:|   |.:|..|:|  ||| 
Zfish   260 FLKQNGYLEFESLTRLGIPDPINYIKKRFKSSRLLFLKTACVGRTIVDQLEASVEEAIN--SAT- 321

  Fly   318 QYLDLTTILPSNLSEEDI----EEVFSTIMAQKHSNPSNFVYLDGIVFSQPYLAQLVQPCQALAE 378
             ::||..:|||.|||||:    .||..::..|     |:...|...|.|:.::|..:...:.|.:
Zfish   322 -WVDLQPMLPSILSEEDVGILLNEVLRSMNVQ-----SSARLLSTSVVSEKFIAGCIALFEDLMQ 380

  Fly   379 SQAKAAI-DGGVYQQYIVEKTLAQKGNVSTQELEDEGKVDKRDERRKKASSG----KAGGGAQGR 438
            .:|:..: :..|:  .|.|..:.|..  :..|.....|.||||||||||:.|    |:|||...|
Zfish   381 QKAQKEVKNNPVF--LITEDDVKQSS--ALLETSASSKKDKRDERRKKAAEGGGSVKSGGGGNAR 441

  Fly   439 ETKTKSTKKHQRGKAAAQFDSDDE-DDAQQGSRGGGGASKKAVKPLELV---KTADIVKLITASL 499
            |.:.:.|||    |...:.|||:| ..:.||....|.....:|:.:..|   |..|..:.:...|
Zfish   442 EIRIRKTKK----KGRKEEDSDEETTHSSQGRNKLGDVQFLSVEEIVEVLEEKVCDSSEEMLQEL 502

  Fly   500 EEEGLEHLSKSIASLYTNQFNQTALARAQELFEATPQTNRRQTHAAIQDRINTLLIDIRLYEKGL 564
            .|:....|||....:.|..|..|:.:.|        ..:|::....:|:.||.|..:|||:|||.
Zfish   503 AEQLQRPLSKMYQEVVTTAFLSTSSSGA--------GGSRKKNMKDLQEEINNLYNNIRLFEKGT 559

  Fly   565 KLFPQDTQTQLVKYLLKSLGNEICNELSLYVASECNLTVKNTNLNVDQRNKLAQECEAQYRAALL 629
            |||..:||..:.|::||::..::.|.|..:||:|...:..:..:..:.|.|:..:...:.|:.|:
Zfish   560 KLFSDETQATVAKHVLKTVCTDVTNVLLSFVAAEHMTSDSSAAMTSEIRLKILAKLSDEVRSPLM 624

  Fly   630 EQNKALN-KSIDDFELATETVLKTCSMIIKKVDKKKDRLLIADHKKKLQKQLLECNEPALLLHLA 693
            :.:.:|| |:|::|....||..:.|.:.:||.|||::|..::.|::.|.:||.:..:|||:|||.
Zfish   625 KLHNSLNGKAIEEFLSCLETSAEECGLFLKKGDKKRERQALSVHRQALCEQLRDAEDPALVLHLT 689

  Fly   694 ALILFTTITGSILHASGKFVSAILQHIRGSLNEDQNALLLRYHDLVLQVL---------QAIP-- 747
            :::||..:|..:|||.|:.|..|:..::..:.|||:.||.:|..||::.|         :.:|  
Zfish   690 SVLLFQNVTHCMLHAPGRCVPHIIGFLQSKIPEDQHKLLSQYQSLVVKQLVVQGHGAEKKTVPPE 754

  Fly   748 ------DSNESKLANEHLQTMQNQVVE--LAQ 771
                  ||::::.....|.::...:.:  |||
Zfish   755 GAGGPADSDDTESLQRELHSLSRDIKDTVLAQ 786

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ufl1NP_001246957.1 DUF2042 7..271 CDD:286786 123/269 (46%)
ufl1NP_956900.1 DUF2042 7..275 CDD:286786 123/269 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C311319798
eggNOG 1 0.900 E1_KOG2235
Hieranoid 1 1.000
Homologene 1 1.000 H9093
Inparanoid 1 1.050 462 1.000 Inparanoid score I1489
OMA 1 1.010
OrthoDB 1 1.010 D244863at33208
OrthoFinder 1 1.000 FOG0006450
OrthoInspector 1 1.000 T1053461
orthoMCL 1 0.900 OOG5_130013
Panther 1 1.100 LDO PTHR31057
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2878
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.