DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ufl1 and Ufl1

Sequence 1:NP_001246957.1 Gene:Ufl1 FlyBaseID:FBgn0037467 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001119751.1 Gene:Ufl1 RGDID:1309308 Length:793 Species:Rattus norvegicus

Alignment Length:834 Identity:294/835 (35%)
Similarity:471/835 (56%) Gaps:96/835 (11%)


  Fly     1 MGSDWDEIKRLAADFQKAQLTSTLQKLSERNCVEIVTLLLEKQMLEVVFTNDGKEYITPDHLERE 65
            |...|:||:|||||||:||...:.|:||||||:|||..|:.::.||||.|.||||||||..:.:|
  Rat     1 MADAWEEIRRLAADFQRAQFAESTQRLSERNCIEIVNKLISQKQLEVVHTLDGKEYITPAQISKE 65

  Fly    66 IQDELYVNGGRANLVEVSKTLNVDLSRIELLAERISAENQSVHLVLGQLIDEDYISHIAQEINEK 130
            ::|||:|.|||.|:|::.:.:||||:.||.....|....:.|.:|||||:||:|:..:::|:|:|
  Rat    66 MRDELHVRGGRVNIVDLQQVINVDLTHIENRVGDIIKSEKHVQMVLGQLVDENYLDRLSEEVNDK 130

  Fly   131 LVQRGEVSISELASQFDLPSDFLQHDVVEKHLGKIIKGRQDASNPRVFFTQAYIQRCKAKIRGAL 195
            |.:.|:|::|||...:|||.|||...:.:: ||:||.|..|..|..|.||:|::.|.||:|||..
  Rat   131 LQESGQVTVSELCKTYDLPGDFLTQALTQR-LGRIINGHLDLDNRGVIFTEAFVARHKARIRGLF 194

  Fly   196 AAITRPINVAVILQKIGVQEKIFYSLLDEIAPAGQ-----VTSKQANSQYVPHIYAKTQADWVNS 255
            :|||||..|..::.|.|.||::.||:|:|:...|:     |..:|..:.:||.||::||:.||:|
  Rat   195 SAITRPTAVNSLVSKYGFQEQLLYSVLEELVSTGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDS 259

  Fly   256 FYKQNSFLEYDAIQKLGISDAKSYIRKQFPNEEFLYLKRVALGARLVELTVVTALNECSATKQYL 320
            |::||.:||:||:.:|||.||.:||:|::.|...|:||...:|..||: .|..::.|..::..::
  Rat   260 FFRQNGYLEFDALSRLGIPDAVNYIKKRYKNTPLLFLKATCVGQGLVD-QVEASVEEAISSGTWV 323

  Fly   321 DLTTILPSNLSEEDIEEVFSTIMAQKHSNPSNFVYLDGIVFSQPYLAQLVQPCQAL--------A 377
            |::.:|||:||.||...:...:|.....:.|..|:.|.:|.|:.:    :..|..|        |
  Rat   324 DVSPLLPSSLSVEDAAMLLQQVMRPFGKHASATVFSDTVVVSEKF----INDCTKLFSERMHQKA 384

  Fly   378 ESQAKAAIDGGVYQQYIVEKTLAQKGNVSTQELEDEGKVDKRDERRKKASSG----KAGGGAQGR 438
            |.:.|   :..|:  .|.|:.|.|   :|..|..:..|.||:|||||||:.|    :.|||...|
  Rat   385 EKEMK---NNPVH--LITEEDLKQ---ISILESVNTNKKDKKDERRKKATEGSGSVRGGGGGNAR 441

  Fly   439 ETKTKSTKKHQRGKAAAQFDSDDEDDAQQGSRGGGGASKKAVKPLELVKTADIVKLITASLE--- 500
            |.|.|..||..|       ..:|.||..|.|..|    ||  ||       ||..:....:|   
  Rat   442 EYKIKKVKKKGR-------KDEDSDDESQSSHAG----KK--KP-------DITFMFQDEIEGCL 486

  Fly   501 ------------EEGLEHLSKSIASLYTNQFNQTALARAQELFEATPQ---TNRRQTHAAIQDRI 550
                        .|..|||.|.:..:|        |...:.:|.::..   |.|::|...:|:.:
  Rat   487 RKHIPDAPEEFISELAEHLIKPLNKMY--------LEVVRSVFMSSTSASGTGRKRTIKDLQEEV 543

  Fly   551 NTLLIDIRLYEKGLKLFPQDTQTQLVKYLLKSLGNEICNELSLYVASECNLTVKN-TNLNVDQRN 614
            :.|..:|||:|||:|.|..||||.|.|:|||::..:|.|.:..::||:..:.|:: ..:..|.|.
  Rat   544 SNLYNNIRLFEKGMKYFADDTQTALTKHLLKTVCTDITNLMFNFLASDLMMAVEDPATITSDMRK 608

  Fly   615 KLAQECEAQYRAALLEQNKALN-KSIDDFELATETVLKTCSMIIKKVDKKKDRLLIADHKKKLQK 678
            |:..:...:.:.||.:.:.:|| |||:||....::..:.|.:::||.|||::|.::..|::.|..
  Rat   609 KILSKLTEETKVALTKLHNSLNEKSIEDFLSCLDSATEACDIMVKKGDKKRERQILFQHRQALAD 673

  Fly   679 QLLECNEPALLLHLAALILFTTITGSILHASGKFVSAILQHIRGSLNEDQNALLLRYHDLVLQVL 743
            ||....:|||:|||.:::||...|.|:|||.|:.|..|:..:...:.|||:.||::|..||::.|
  Rat   674 QLKVTEDPALILHLTSVLLFQFSTHSMLHAPGRCVPQIIAFLHNKIPEDQHTLLVKYQGLVVKQL 738

  Fly   744 QA---------IPDSNE--------SKLANEHLQTMQNQVVELAQNFSRASISK 780
            .:         .|.|::        :....:.||.:...:.:|.....::|:::
  Rat   739 VSQNKKSGQGEDPSSDDLDKEQHDVTNTTRKELQELSLSIKDLVLKPRKSSVTE 792

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ufl1NP_001246957.1 DUF2042 7..271 CDD:286786 126/269 (47%)
Ufl1NP_001119751.1 Required for E3 UFM1-protein ligase activity. {ECO:0000250|UniProtKB:O94874} 2..212 101/210 (48%)
Mediates interaction with DDRGK1. {ECO:0000250|UniProtKB:O94874} 2..200 97/198 (49%)
DUF2042 7..275 CDD:286786 129/273 (47%)
Involved in CDK5RAP3-binding. {ECO:0000250|UniProtKB:O94874} 121..250 55/134 (41%)
Mediates interaction with TRIP4. {ECO:0000250|UniProtKB:O94874} 200..400 70/213 (33%)
Mediates interaction with CDK5RAP3. {ECO:0000269|PubMed:20531390} 490..683 61/213 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C311320942
eggNOG 1 0.900 E1_KOG2235
Hieranoid 1 1.000
Homologene 1 1.000 H9093
Inparanoid 1 1.050 483 1.000 Inparanoid score I1376
OMA 1 1.010
OrthoDB 1 1.010 D244863at33208
OrthoFinder 1 1.000 FOG0006450
OrthoInspector 1 1.000 T1087822
orthoMCL 1 0.900 OOG5_130013
Panther 1 1.100 LDO PTHR31057
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.