DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ufl1 and UFL1

Sequence 1:NP_001246957.1 Gene:Ufl1 FlyBaseID:FBgn0037467 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_056138.1 Gene:UFL1 HGNCID:23039 Length:794 Species:Homo sapiens

Alignment Length:813 Identity:290/814 (36%)
Similarity:471/814 (58%) Gaps:53/814 (7%)


  Fly     1 MGSDWDEIKRLAADFQKAQLTSTLQKLSERNCVEIVTLLLEKQMLEVVFTNDGKEYITPDHLERE 65
            |...|:||:|||||||:||.....|:||||||:|||..|:.::.||||.|.||||||||..:.:|
Human     1 MADAWEEIRRLAADFQRAQFAEATQRLSERNCIEIVNKLIAQKQLEVVHTLDGKEYITPAQISKE 65

  Fly    66 IQDELYVNGGRANLVEVSKTLNVDLSRIELLAERISAENQSVHLVLGQLIDEDYISHIAQEINEK 130
            ::|||:|.|||.|:|::.:.:||||..||.....|....:.|.|||||||||:|:..:|:|:|:|
Human    66 MRDELHVRGGRVNIVDLQQVINVDLIHIENRIGDIIKSEKHVQLVLGQLIDENYLDRLAEEVNDK 130

  Fly   131 LVQRGEVSISELASQFDLPSDFLQHDVVEKHLGKIIKGRQDASNPRVFFTQAYIQRCKAKIRGAL 195
            |.:.|:|:||||...:|||.:||...:.:: ||:||.|..|..|..|.||:|::.|.||:|||..
Human   131 LQESGQVTISELCKTYDLPGNFLTQALTQR-LGRIISGHIDLDNRGVIFTEAFVARHKARIRGLF 194

  Fly   196 AAITRPINVAVILQKIGVQEKIFYSLLDEIAPAGQ-----VTSKQANSQYVPHIYAKTQADWVNS 255
            :|||||..|..::.|.|.||::.||:|:|:..:|:     |..:|..:.:||.||::||:.||:|
Human   195 SAITRPTAVNSLISKYGFQEQLLYSVLEELVNSGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDS 259

  Fly   256 FYKQNSFLEYDAIQKLGISDAKSYIRKQFPNEEFLYLKRVALGARLVELTVVTALNECSATKQYL 320
            |::||.:||:||:.:|||.||.|||:|::...:.|:||...:|..||: .|..::.|..::..::
Human   260 FFRQNGYLEFDALSRLGIPDAVSYIKKRYKTTQLLFLKAACVGQGLVD-QVEASVEEAISSGTWV 323

  Fly   321 DLTTILPSNLSEEDIEEVFSTIMAQKHSNPSNFVYLDGIVFSQPYLAQLVQPCQALAESQAKAAI 385
            |:..:||::||.||...:...:|.......|..|:.|.:|.|:.::....:..:.|...:|:..:
Human   324 DIAPLLPTSLSVEDAAILLQQVMRAFSKQASTVVFSDTVVVSEKFINDCTELFRELMHQKAEKEM 388

  Fly   386 DGGVYQQYIVEKTLAQKGNVSTQELEDEGKVDKRDERRKKASSG----KAGGGAQGRETKTKSTK 446
            ..... ..|.|:.|.|   :||.|.....|.||:||||:||:.|    :.|||...||.|.|..|
Human   389 KNNPV-HLITEEDLKQ---ISTLESVSTSKKDKKDERRRKATEGSGSMRGGGGGNAREYKIKKVK 449

  Fly   447 KHQRGKAAAQFDSDDEDDAQQGSRGGGGASKKAVKP-LELVKTADIVKLITASLEEEGLEHLSKS 510
            |..|       ..||.||..|.|..|    ||  || :..:...:|...:...:::...|.:|: 
Human   450 KKGR-------KDDDSDDESQSSHTG----KK--KPEISFMFQDEIEDFLRKHIQDAPEEFISE- 500

  Fly   511 IASLYTNQFNQTALARAQELFEATPQ----TNRRQTHAAIQDRINTLLIDIRLYEKGLKLFPQDT 571
            :|.......|:|.|...:.:|.::..    |.|::|...:|:.::.|..:|||:|||:|.|..||
Human   501 LAEYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIRLFEKGMKFFADDT 565

  Fly   572 QTQLVKYLLKSLGNEICNELSLYVASECNLTVKN-TNLNVDQRNKLAQECEAQYRAALLEQNKAL 635
            |..|.|:||||:..:|.|.:..::||:..:.|.: ..:..:.|.|:..:...:.:.||.:.:.:|
Human   566 QAALTKHLLKSVCTDITNLIFNFLASDLMMAVDDPAAITSEIRKKILSKLSEETKVALTKLHNSL 630

  Fly   636 N-KSIDDFELATETVLKTCSMIIKKVDKKKDRLLIADHKKKLQKQLLECNEPALLLHLAALILFT 699
            | |||:||....::..:.|.:::|:.|||::|.::..|::.|.:||....:|||:|||.:::||.
Human   631 NEKSIEDFISCLDSAAEACDIMVKRGDKKRERQILFQHRQALAEQLKVTEDPALILHLTSVLLFQ 695

  Fly   700 TITGSILHASGKFVSAILQHIRGSLNEDQNALLLRYHDLVLQVLQA---------IPDSNE---- 751
            ..|.|:|||.|:.|..|:..:...:.|||:|||::|..||::.|.:         .|.:||    
Human   696 FSTHSMLHAPGRCVPQIIAFLNSKIPEDQHALLVKYQGLVVKQLVSQSKKTGQGDYPLNNELDKE 760

  Fly   752 ----SKLANEHLQTMQNQVVELAQNFSRASISK 780
                :....:.||.:.:.:.:|.....::|:::
Human   761 QEDVASTTRKELQELSSSIKDLVLKSRKSSVTE 793

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ufl1NP_001246957.1 DUF2042 7..271 CDD:286786 129/269 (48%)
UFL1NP_056138.1 Required for E3 UFM1-protein ligase activity. {ECO:0000269|PubMed:20018847} 2..212 105/211 (50%)
Mediates interaction with DDRGK1. {ECO:0000269|PubMed:25219498} 2..200 101/199 (51%)
DUF2042 7..275 CDD:313039 129/269 (48%)
Involved in CDK5RAP3-binding. {ECO:0000269|PubMed:20164180} 121..250 54/130 (42%)
Mediates interaction with TRIP4. {ECO:0000269|PubMed:25219498} 200..400 63/202 (31%)
Mediates interaction with CDK5RAP3. {ECO:0000250|UniProtKB:B2GV24} 490..684 57/195 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C311322079
eggNOG 1 0.900 E1_KOG2235
Hieranoid 1 1.000
Homologene 1 1.000 H9093
Inparanoid 1 1.050 487 1.000 Inparanoid score I1417
Isobase 1 0.950 0 Normalized mean entropy S6103
OMA 1 1.010
OrthoDB 1 1.010 D244863at33208
OrthoFinder 1 1.000 FOG0006450
OrthoInspector 1 1.000 T1074177
orthoMCL 1 0.900 OOG5_130013
Panther 1 1.100 LDO PTHR31057
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2878
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.