DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ufl1 and ufl-1

Sequence 1:NP_001246957.1 Gene:Ufl1 FlyBaseID:FBgn0037467 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_501090.1 Gene:ufl-1 WormBaseID:WBGene00015555 Length:735 Species:Caenorhabditis elegans

Alignment Length:789 Identity:194/790 (25%)
Similarity:341/790 (43%) Gaps:135/790 (17%)


  Fly     3 SDWDEIKRLAADFQKAQLTSTLQKLSERNCVEIVTLLLEKQMLEVVFTNDGKEYITPDHLEREIQ 67
            :.|.:|::||:|.|:.||:.:.:||||.||:|::..|:....::||:|.||..|:|.:|||.||:
 Worm     2 TSWADIQKLASDLQRVQLSQSSKKLSEVNCIEVLQKLIASHRIDVVYTRDGHSYVTKNHLETEIK 66

  Fly    68 DELYVNGGRANLVEVSKTLNVDLSRIELLAERISAENQSVHLVLGQLIDEDYISHIAQEINEKLV 132
            :|....||||:|.:::..||:|...||..:..|.:.:....:...::...:|:..:..|:...|.
 Worm    67 NECIAAGGRASLTDIAVALNIDFDHIEKTSRLIVSTDDEFTISNAEIFATEYVHRLRNELRTLLD 131

  Fly   133 QRGEVSISELASQFDLPSDFLQHDVVEKHLGKIIKGRQDASNPRVFFTQAYIQRCKAKIRGALAA 197
            ::|..:.:.|...::|.|:.||..::||......:|..|..   ..:|.:::...:..:|..|.|
 Worm   132 EQGNQTTAALCKHWNLSSELLQSLLIEKLGSSDFQGVVDGD---TIYTSSFLNARQLVLRAILIA 193

  Fly   198 ITRPINVAVILQKIGVQEKIFYSLLDEIAPAGQVTSKQANSQ------YVPHIYAKTQADWVNSF 256
            :|:...::.|.:::|:..|.|:...:.:...|::......|:      |.|.:|.......|.:.
 Worm   194 LTKITPISTIQKRVGLTPKRFWIAFENLQSLGEIPGTLIGSRTSPSCSYRPMMYDHLVKSCVLNQ 258

  Fly   257 YKQNSFLEYDAIQKLGISDAKSYIRKQFPNEEF---LYLKRVALGARLVEL---TVVTALNECSA 315
            |:||.|||...::.||: |||..:.:...:.||   :.::.:.:...|::.   .|...|.:...
 Worm   259 YRQNEFLEISTLKTLGV-DAKPALEEVLGSSEFKKLVSMRSMFMTKELMDQCINAVQEDLQKSGI 322

  Fly   316 TKQYLDLTTI-LPSNLSEEDIEEVFSTIM-AQKHSNPSNFVYLDGIVFSQPYLAQLVQPCQALAE 378
            :..:|.|.:: ||.:.::||  |:.|.:. .:|.|:     :.:|.||....|.:.::....|.:
 Worm   323 SDVHLALQSLNLPLDTADED--EIGSKVANVEKDSH-----FAEGFVFKGAVLTEALRSIDKLLD 380

  Fly   379 SQAKAAIDGGVYQQYIVEKTLAQKGNVSTQELEDEGKVDKRDERRKKASSGKAGGGAQGRETKTK 443
            .:|...:|                                    |.:|...|.||          
 Worm   381 VRAHEEVD------------------------------------RLEAEKKKQGG---------- 399

  Fly   444 STKKHQRGKAA--AQFDSDDEDDAQQGSRGG-------GGASKKAVKPLELVKTADIVKLITASL 499
                   .|||  .|.::||..|.::|.:||       .|.||.:........:|:|      |:
 Worm   400 -------AKAAVKVQEETDDWGDGKKGGKGGKKNAKSVKGGSKSSAPSTSSNLSANI------SI 451

  Fly   500 EEEGLE-------HLSKSIASLYTNQFNQ--TALAR-------AQELFEATPQTNRRQTHAAIQD 548
            ..|.||       .:.:.|.|:...:.||  |.|.|       |.:|..:.  .|.:::.:||.|
 Worm   452 NSEELEIWLRESQSVPEEILSVIVEKLNQETTTLLRKKVQDIQAHQLVASV--ANSKKSLSAIGD 514

  Fly   549 RINTLLIDIRLYEKGLKLFPQDTQTQLVKYLLKSLGNEICNELSLYVASECNLTVKNTN-LNVDQ 612
            :...|......:|.....|.....:.|.:||||::||||...|..||     :.|.|.: |...|
 Worm   515 KCRQLYDSFNTFETATSTFADPLGSDLRQYLLKTVGNEIALALLSYV-----MGVDNAHQLKEKQ 574

  Fly   613 RNKLAQECEAQYRAALLEQNKALNKSIDDFELATETVLKTC------SMIIKKVDKKKDRLLIAD 671
            |.:..:......|..:.....:|..:.||........:..|      |:.:||||||....:.|.
 Worm   575 REETIENLPEMLRDPIRSVFASLKSTDDDALDKFHDAVYNCSAPSATSLALKKVDKKGRAEVGAK 639

  Fly   672 HKKKLQKQLLECNEPALLLHLAALILFTTITGSILHASGKFVSAILQHIRGSLNEDQNALLLRYH 736
            ...:|.:||....|||..|.|:.|.:... .|....|||||||.::..|:....|:         
 Worm   640 ITAELHEQLCSQTEPATTLLLSVLYILAK-AGRPTTASGKFVSQLVAQIKDLCPEN--------- 694

  Fly   737 DLVLQVLQA 745
              |..:|||
 Worm   695 --VFDLLQA 701

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ufl1NP_001246957.1 DUF2042 7..271 CDD:286786 73/270 (27%)
ufl-1NP_501090.1 DUF2042 6..273 CDD:286786 73/270 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C311306465
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 198 1.000 Inparanoid score I2457
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D244863at33208
OrthoFinder 1 1.000 FOG0006450
OrthoInspector 1 1.000 T476576
orthoMCL 1 0.900 OOG5_130013
Panther 1 1.100 LDO PTHR31057
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2878
TreeFam 00.000 Not matched by this tool.
1110.940

Return to query results.
Submit another query.