DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ufl1 and ufl1

Sequence 1:NP_001246957.1 Gene:Ufl1 FlyBaseID:FBgn0037467 Length:782 Species:Drosophila melanogaster
Sequence 2:XP_002934919.2 Gene:ufl1 XenbaseID:XB-GENE-1011775 Length:794 Species:Xenopus tropicalis

Alignment Length:779 Identity:270/780 (35%)
Similarity:462/780 (59%) Gaps:38/780 (5%)


  Fly     1 MGSDWDEIKRLAADFQKAQLTSTLQKLSERNCVEIVTLLLEKQMLEVVFTNDGKEYITPDHLERE 65
            |.:||:||:|||||||:|||:.|:|:||||||:|||..|:.::.|:||.|.|||||:||..:.:|
 Frog     1 MSADWEEIRRLAADFQRAQLSDTVQRLSERNCIEIVAKLIAEKQLDVVHTLDGKEYVTPSQITKE 65

  Fly    66 IQDELYVNGGRANLVEVSKTLNVDLSRIELLAERISAENQSVHLVLGQLIDEDYISHIAQEINEK 130
            |:|||.:.|||.|:||:.:.:||||:.||..|..:...::.:.||||||:|.:|:..||:|:|:|
 Frog    66 IKDELQIRGGRVNIVELQQVINVDLTHIESRANDLVKLDKDIQLVLGQLVDGNYLDQIAEEVNDK 130

  Fly   131 LVQRGEVSISELASQFDLPSDFLQHDVVEKHLGKIIKGRQDASNPRVFFTQAYIQRCKAKIRGAL 195
            |...|:|:||||...:|||.|||: :.....||:||:|:.|.||..||:|:|::.:.:|:|||..
 Frog   131 LQAAGQVTISELCKTYDLPGDFLK-ESFSLRLGRIIQGKIDESNRGVFYTEAFVAQHRARIRGLF 194

  Fly   196 AAITRPINVAVILQKIGVQEKIFYSLLDEIAPAGQ-----VTSKQANSQYVPHIYAKTQADWVNS 255
            .|||:|..|:.::...|.||.:.||||:|:...|:     |..:|..:.::|.||||||::|:::
 Frog   195 TAITKPTPVSNMISIYGFQEHLLYSLLEELVNCGRLKGTVVGGRQDKAVFMPDIYAKTQSNWIDA 259

  Fly   256 FYKQNSFLEYDAIQKLGISDAKSYIRKQFPNEEFLYLKRVALGARLVELTVVTALNECSATKQYL 320
            |:|||.:||:|::.:|||.|...||:|::.:...||||...:|..:|: .|..::.|..::..:|
 Frog   260 FFKQNCYLEFDSLSRLGIPDPVGYIKKRYKSTHMLYLKSACIGQGIVD-HVEASVEEAISSGSWL 323

  Fly   321 DLTTILPSNLSEEDIEEVFSTIMAQKHSNPSNFVYLDGIVFSQPYLAQLVQPCQAL----AESQA 381
            |:..:|||.||:||...:...::...:::.|..|:.|.||.|:.::::.......|    ||.:.
 Frog   324 DIMPLLPSCLSQEDAGILLQQVIRTLNNSSSARVFGDTIVVSEKFISECANLFNKLMHHKAEKEM 388

  Fly   382 KAAIDGGVYQQYIVEKTLAQKGNVSTQELEDEGKVDKRDERRKKASSG----KAGGGAQGRETKT 442
            |::   .|:  .:.|:.|.|...:..:.|   .|.||::||||||:.|    :.||....||.|.
 Frog   389 KSS---PVF--IVTEEDLKQAAILENEVL---SKKDKKEERRKKATEGSGSTRTGGCGNAREIKI 445

  Fly   443 KSTKKHQRGKAAAQFDSDDEDDAQQGSRGGGGASKKAVKPLELVKTADIVKLITASLEEEGLEHL 507
            |.:||..|        .|::||..|.|..|....::|.. :.|.:..|:::.......:|.:..|
 Frog   446 KKSKKKAR--------KDEDDDESQTSYPGKPKEREAAF-MSLEEIQDVLRKHAPDSPDELVIEL 501

  Fly   508 SKSIASLYTNQFNQTALARAQELFEATPQTNRRQTHAAIQDRINTLLIDIRLYEKGLKLFPQDTQ 572
            |:::....|..:.:...:.......::...:|:||....|:.:.:|..:|||:|:|:|.|..:||
 Frog   502 SENLIRPLTKSYQEVVRSVFLSSTSSSSGASRKQTMKDFQEEVTSLYNNIRLFERGIKFFTDETQ 566

  Fly   573 TQLVKYLLKSLGNEICNELSLYVASECNLTVKN-TNLNVDQRNKLAQECEAQYRAALLEQNKALN 636
            ..|.|:|||::..:|.|.:..::|::..:..:: |.:..:.|.|:..:.:.:.:..|.:.:.:|:
 Frog   567 NNLAKHLLKTICTDITNIIFNFLAADFMMAAEDYTTITSEVRKKMLSKLQEEAKGPLTKLHSSLS 631

  Fly   637 -KSIDDFELATETVLKTCSMIIKKVDKKKDRLLIADHKKKLQKQLLECNEPALLLHLAALILFTT 700
             |||::|....::....|.:::||.||||:|.::..|:..|.:||....:|||:|||.::::|..
 Frog   632 GKSIEEFSSYVDSAADACGILMKKGDKKKERQIMFQHRHALIEQLKVTEDPALVLHLTSVLMFQL 696

  Fly   701 ITGSILHASGKFVSAILQHIRGSLNEDQNALLLRYHDLVLQVLQAIPDSNESKLANEHLQTMQN 764
            .|..:|||.|:.|..|:..:...:.|||:.||:.|..||::.|    ..|..:...|...||::
 Frog   697 TTHCMLHAPGRCVPQIIAFLHTKIPEDQHKLLVNYQTLVVKQL----IGNTKQKDEEDEDTMED 756

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ufl1NP_001246957.1 DUF2042 7..271 CDD:286786 126/269 (47%)
ufl1XP_002934919.2 DUF2042 7..275 CDD:286786 126/269 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C311320031
eggNOG 1 0.900 E1_KOG2235
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9093
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D244863at33208
OrthoFinder 1 1.000 FOG0006450
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.