DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Antp and HB16

Sequence 1:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_195716.1 Gene:HB16 AraportID:AT4G40060 Length:294 Species:Arabidopsis thaliana

Alignment Length:114 Identity:31/115 (27%)
Similarity:46/115 (40%) Gaps:16/115 (14%)


  Fly   270 QNPNSQSSGMPSPL------------YPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYL 322
            |:|....|...|.|            |.......|..::::|.:..    |...|||.|.....|
plant    21 QSPRGYGSNYQSMLEGYDEDATLIEEYSGNHHHMGLSEKKRRLKVD----QVKALEKNFELENKL 81

  Fly   323 TRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEI 371
            ...|:.::|..|.|..||:.:||||||.:||.:...|......|:.|.:
plant    82 EPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKGQYDSL 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 Homeobox 301..353 CDD:278475 19/52 (37%)
HB16NP_195716.1 Homeobox 59..112 CDD:278475 20/57 (35%)
HALZ 114..154 CDD:280364 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
10.910

Return to query results.
Submit another query.