DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Antp and meox2b

Sequence 1:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001038589.1 Gene:meox2b ZFINID:ZDB-GENE-060503-853 Length:289 Species:Danio rerio

Alignment Length:260 Identity:77/261 (30%)
Similarity:101/261 (39%) Gaps:54/261 (21%)


  Fly   140 PQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLG---MVPE--GGSPPL-----VDQMSGHHMNAQ 194
            |....|..||...|             |:.|..   ..|:  |.|||.     .....|.|....
Zfish    12 PHAPSQALHPAFTQ-------------ALHGRSDHISYPDLPGPSPPCSYAGEESSFGGAHHRVH 63

  Fly   195 MTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPV---GAPPQGMMHQGQGPPQ 256
             ..|.|..|||....:    ||.:..:....|.:.:....:..|.:   ||..|||.   .|.|.
Zfish    64 -PAPQHPHHPQHHQWH----VPQMPSIESERHGLCLPHPDAAAPELCGTGAGSQGMC---AGNPT 120

  Fly   257 MHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGK---------------CQERKRGRQTYTR 306
            :....|   :..|..|........||:.|..||..||               ..:.::.|..:|:
Zfish   121 LTGSDP---SGVSCVPGEYGRQNMSPVEPERRSSKGKSDSSDSQDGSYKSDVSSKPRKERTAFTK 182

  Fly   307 YQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEI 371
            .|..|||.||..:.||||.||.|||..|.|||||:|:||||||||||:..  .|:.|:.....|:
Zfish   183 EQIRELESEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVK--GGQQGAAAREKEL 245

  Fly   372  371
            Zfish   246  245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 Homeobox 301..353 CDD:278475 33/52 (63%)
meox2bNP_001038589.1 Homeobox 177..229 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.