DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Antp and meox2a

Sequence 1:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_017206696.1 Gene:meox2a ZFINID:ZDB-GENE-080613-1 Length:302 Species:Danio rerio

Alignment Length:275 Identity:75/276 (27%)
Similarity:100/276 (36%) Gaps:81/276 (29%)


  Fly   140 PQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPE--GGSPPLVDQMSGHHMNAQMTLPHHMG 202
            |....|..||           :..|......|...|:  ..|||....:||           :.|
Zfish    12 PHAPPQAVHP-----------AFALHGRPEHLSSYPDLSSSSPPSTCIVSG-----------YPG 54

  Fly   203 HPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSG--VPP----------------VGAPPQGMMH 249
            ......|....|:....:.|.:||:.....||.|  :|.                :..|..|...
Zfish    55 EDGGLFGGHQRGLSVSQQQHHHHHHHHHLAQQGGWHLPQSSSASPSAAGVRLGLGISGPDSGSSD 119

  Fly   250 QGQGPPQMHQGHP------------------GQHT---PPSQNPNSQSSGMPSPLYPWMRSQFGK 293
            .|.|.|.:....|                  |:||   ..::..||:.....|      .||.|.
Zfish   120 VGPGGPSLCASTPSLGAGVPSGASCVPGGDFGRHTMSPAEAEKRNSKRRSDSS------ESQDGN 178

  Fly   294 -----CQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 353
                 ..:.::.|..:|:.|..|||.||..:.||||.||.|||..|.|||||:|:||||||||||
Zfish   179 YKSDVSSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWK 243

  Fly   354 KENKTKGEPGSGGEG 368
               :.||    |.:|
Zfish   244 ---RVKG----GQQG 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 Homeobox 301..353 CDD:278475 33/52 (63%)
meox2aXP_017206696.1 COG5576 161..267 CDD:227863 44/105 (42%)
Homeobox 191..243 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.