DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Antp and ftz

Sequence 1:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_477498.1 Gene:ftz FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster

Alignment Length:399 Identity:125/400 (31%)
Similarity:174/400 (44%) Gaps:94/400 (24%)


  Fly     3 MSTNNCESMTSYFTNSYMGADMHHGH------YPGNGVTDLDAQQMHHYSQNANHQGNMPYPRFP 61
            |:|.|.:|..||..|..| .:|:|.|      |..:|       ...:|...:|:||.  ||:..
  Fly     1 MATTNSQSHYSYADNMNM-YNMYHPHSLPPTYYDNSG-------SNAYYQNTSNYQGY--YPQES 55

  Fly    62 PYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQ 126
            ..:...|||       .|.||.::...|      |.|...       |.:..:::.:........
  Fly    56 YSESCYYYN-------NQEQVTTQTVPP------VQPTTP-------PPKATKRKAEDDAASIIA 100

  Fly   127 QAQQAPQQLQQQLPQVTQQV--------THPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSP-PL 182
            ..::.|..|:..|....:::        |..:|.::.|.|  |.|:.|            || |.
  Fly   101 AVEERPSTLRALLTNPVKKLKYTPDYFYTTVEQVKKAPAV--STKVTA------------SPAPS 151

  Fly   183 VDQMSGHHMNAQMTLPHHMGHPQA--QLGYTDVGVP-DVTEVHQNHHNMGMYQQQSGVPPVGAPP 244
            .||       ..:|:|    .|.|  .:.|.||..| ..|:..:|    |.:.......|...||
  Fly   152 YDQ-------EYVTVP----TPSASEDVDYLDVYSPQSQTQKLKN----GDFATPPPTTPTSLPP 201

  Fly   245 -QGMMHQGQGPPQMHQGHPGQHTPP--SQNPNSQSSGMPSPL--YPWMRSQ---FGKCQERKRGR 301
             :|:    ..|||    .||:.:..  ||..|.:....|:..  :.|...:   ...|::.||.|
  Fly   202 LEGI----STPPQ----SPGEKSSSAVSQEINHRIVTAPNGAGDFNWSHIEETLASDCKDSKRTR 258

  Fly   302 QTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGG 366
            ||||||||||||||||||||:||||||:||:||.|:||||||||||||||.||:......|...|
  Fly   259 QTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKDRTLDSSPEHCG 323

  Fly   367 EG-DEITPP 374
            .| ..:.||
  Fly   324 AGYTAMLPP 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 Homeobox 301..353 CDD:278475 46/52 (88%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 69/314 (22%)
Homeobox 257..310 CDD:278475 46/53 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45659
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.