DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Antp and Scr

Sequence 1:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001356915.1 Gene:Scr FlyBaseID:FBgn0003339 Length:508 Species:Drosophila melanogaster

Alignment Length:431 Identity:147/432 (34%)
Similarity:177/432 (41%) Gaps:130/432 (30%)


  Fly     7 NCESMTSY-FTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGN----------MP---- 56
            :|.:|:|| |.||....      ||    ..::.||.|..:.|::..|:          :|    
  Fly     4 DCFAMSSYQFVNSLASC------YP----QQMNPQQNHPGAGNSSAGGSGGGAGGSGGVVPSGGT 58

  Fly    57 ----------------------------YPRFPP--YDRMPYYNGQGMDQQQQHQVYSRPDSPSS 91
                                        ||..|.  |.....|.|||           .||    
  Fly    59 NGGQGSAGAATPGANDYFPAAAAYTPNLYPNTPQAHYANQAAYGGQG-----------NPD---- 108

  Fly    92 QVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQP 156
                ::...|...|..:.|||||||||...:.....|.|..|||.||        .||||||||.
  Fly   109 ----MVDYTQLQPQRLLLQQQQQQQQQQHAHAAAAVAAQQQQQLAQQ--------QHPQQQQQQQ 161

  Fly   157 VVYASCKL---QAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDV----G 214
            ....|||.   ....||.|.....||....:..:.::.|:|     .:..|| .|...|:    .
  Fly   162 QANISCKYANDPVTPGGSGGGGVSGSNNNNNSANSNNNNSQ-----SLASPQ-DLSTRDISPKLS 220

  Fly   215 VPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGM--MHQGQGPPQMHQGHPGQHTPPSQNP----- 272
            ...|.|......|.|:.   .|.....|...|:  .|.|.|.    .|.||....|..:|     
  Fly   221 PSSVVESVARSLNKGVL---GGSLAAAAAAAGLNNNHSGSGV----SGGPGNVNVPMHSPGGGDS 278

  Fly   273 -----------NSQSSG----MPSPLYPWMR------SQFGKCQERKRGRQTYTRYQTLELEKEF 316
                       :||:||    .|..:||||:      |......|.||.|.:|||||||||||||
  Fly   279 DSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEF 343

  Fly   317 HFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK 357
            |||||||||||||||||||||||||||||||||||||||:|
  Fly   344 HFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHK 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 Homeobox 301..353 CDD:278475 50/52 (96%)
ScrNP_001356915.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.