DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Antp and mnx1

Sequence 1:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001009885.1 Gene:mnx1 ZFINID:ZDB-GENE-040409-1 Length:311 Species:Danio rerio

Alignment Length:303 Identity:76/304 (25%)
Similarity:100/304 (33%) Gaps:136/304 (45%)


  Fly   127 QAQQAPQQLQQQLP-----------QVTQQVTHP---QQQQQQPVVYASCKLQAAVGGLGMVPEG 177
            :.|.:|..|...||           |..:..|:.   |.:...|...:||         |::|:.
Zfish    19 KVQTSPLALVTSLPTSSISSSSDSVQAVELTTNSDALQTESPSPPRISSC---------GLIPKP 74

  Fly   178 G---SPPLVDQMSGHHMNAQMTLPHHMG----HPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQS 235
            |   ||                   |.|    |||:..|.                         
Zfish    75 GFLNSP-------------------HSGMVGLHPQSSTGI------------------------- 95

  Fly   236 GVPPVGAPPQGMMHQGQGPPQMHQGHP---------GQHTPPSQNPNSQSSGMPSPLYP------ 285
                              |||...|||         |||...|.:....|.....|..|      
Zfish    96 ------------------PPQALYGHPMYTYSAAALGQHPALSYSYPHGSHHHHHPSDPLKLTAS 142

  Fly   286 ------WMR--------------------SQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTR 324
                  |:|                    :..|||   :|.|..:|..|.||||.:|..|:||:|
Zfish   143 SFQLDHWLRVSTAGMMLPKMADFNGQAQSNLLGKC---RRPRTAFTSQQLLELEHQFKLNKYLSR 204

  Fly   325 RRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGE 367
            .:|.|:|.:|.|||.|:||||||||||||:..|.|.:.....|
Zfish   205 PKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQDAE 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 Homeobox 301..353 CDD:278475 31/52 (60%)
mnx1NP_001009885.1 Homeobox 180..233 CDD:278475 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.