DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Antp and vvl

Sequence 1:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001303384.1 Gene:vvl FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster

Alignment Length:403 Identity:93/404 (23%)
Similarity:114/404 (28%) Gaps:167/404 (41%)


  Fly    20 MGADMHHGHYPGNGVTDLDAQQMHHYSQNANH------QGNMPYPRFPPYDRMPYYNGQGMDQQ- 77
            :|.||..|..||:         |||...:.:|      .|...:...|     |..:.|.|... 
  Fly   368 LGGDMMDGMPPGH---------MHHGGYHPHHDMHGSPMGTHSHSHSP-----PMLSPQNMQSSA 418

  Fly    78 -QQHQVYSRPDS---PSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQ-------- 130
             ..||:.:. .|   .|:........|..|......|||||||||..|.|||.|.||        
  Fly   419 VAAHQLAAHXQSEIQESNSAAAASTPASLNSLSQQQQQQQQQQQQQHQQQQQHQQQQHTPNTPSS 483

  Fly   131 -----APQQLQQQLPQV----------------------------------TQQVTHPQQQQQQP 156
                 |....|...||.                                  .:||.|.||||||.
  Fly   484 SAGSSATMTSQVMSPQSPLGSSSAGNQANNNNNNNNNNNSSTNNNNNNNNNEEQVKHHQQQQQQQ 548

  Fly   157 VVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH-MGHPQAQLGYTDVGVPDVTE 220
              .||....||...:.|          |.|...|       ||| ..||...        |.:..
  Fly   549 --QASSIAAAAAAAMYM----------DPMRYQH-------PHHPHPHPHQH--------PHLNP 586

  Fly   221 VHQNH--HNMGMYQ--QQSGV----------------------PPVGAPPQGMM------HQGQG 253
            .|..|  |.....|  ||..|                      ||..|.|.|..      |....
  Fly   587 AHHPHLFHTSDQLQHSQQQTVGGTSSNSQLSPGAGSNSGLPLQPPSSASPAGSASSVLGGHLNLN 651

  Fly   254 PPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEF-- 316
            |  :||.|..||....|:.:.|..                 |::...|:.:      ||..:|  
  Fly   652 P--LHQHHHYQHHHHQQHHHHQQQ-----------------QQQLHARRLF------ELSLQFGA 691

  Fly   317 --------HFNRY 321
                    |||.:
  Fly   692 AAAPGAVRHFNSF 704

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 Homeobox 301..353 CDD:278475 7/32 (22%)
vvlNP_001303384.1 POU 212..286 CDD:197673
Homeobox 307..360 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3844
11.030

Return to query results.
Submit another query.