DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Antp and GSX1

Sequence 1:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_663632.1 Gene:GSX1 HGNCID:20374 Length:264 Species:Homo sapiens

Alignment Length:229 Identity:73/230 (32%)
Similarity:93/230 (40%) Gaps:66/230 (29%)


  Fly   175 PEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYT-------DVGV----PDVTEVHQNHHNM 228
            |||..|||              .|:.:..|.|..|.:       ..|:    |......|.|...
Human    21 PEGSPPPL--------------FPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPP 71

  Fly   229 G---MYQQQSGVPPVGA----PPQGMMHQGQGPPQMHQGHPG---------QHTPPSQNP----- 272
            |   :...::..||.|:    .|.|..|....|...|  .|.         |.:.|..:|     
Human    72 GPPALPLLKASFPPFGSQYCHAPLGRQHSAVSPGVAH--GPAAAAAAAALYQTSYPLPDPRQFHC 134

  Fly   273 ---NSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 334
               :|.|:.:||               .||.|..:|..|.||||:||..|.||:|.||||||..|
Human   135 ISVDSSSNQLPS---------------SKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYL 184

  Fly   335 CLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEG 368
            .|:|:|:||||||||:|.|||.|.....|.||.|
Human   185 NLSEKQVKIWFQNRRVKHKKEGKGSNHRGGGGGG 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 Homeobox 301..353 CDD:278475 32/52 (62%)
GSX1NP_663632.1 SNAG domain. {ECO:0000250} 1..20
Homeobox 151..203 CDD:306543 32/52 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.