DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Antp and gbx1

Sequence 1:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_777286.1 Gene:gbx1 ZFINID:ZDB-GENE-020117-2 Length:316 Species:Danio rerio

Alignment Length:296 Identity:73/297 (25%)
Similarity:102/297 (34%) Gaps:123/297 (41%)


  Fly   175 PEG-GSPPLVDQMSGHHMNAQMTLPHHM---GHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQS 235
            |.| |:...:|.:.|    .....|.|:   |:|.. :.|..:.:|...    :|.::     .|
Zfish     4 PSGTGTAFSIDSLIG----TPQPRPGHLLYTGYPMF-MPYRPLMIPQAL----SHSSL-----PS 54

  Fly   236 GVPPVGAPPQGMMHQ---------GQGPPQM---------HQGHPGQHTPPSQNP----NSQSSG 278
            |:||: ||......:         |||.|.|         ....|....||.:.|    .:..:|
Zfish    55 GIPPL-APLASFAGRLTNTFCAGLGQGMPSMVALTTTLPSFSDPPDSFYPPQEMPGPRLGADGTG 118

  Fly   279 M---PSP------------------------LYPW------MRSQFGKCQER------------- 297
            |   .||                        ||..      :::....|.:|             
Zfish   119 MNRQESPHDELKGSELLNFTETFQAVAGETKLYSSDDEKLDLKAAEAACSDREDSSADSENESFS 183

  Fly   298 -------------------------------KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIA 331
                                           :|.|..:|..|.||||||||..:||:...|.:||
Zfish   184 DGNTCASASQKGKLKGGSQDALPPGGSAGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIA 248

  Fly   332 HALCLTERQIKIWFQNRRMKWKK-----ENKTKGEP 362
            |||.|:|.|:||||||||.|||:     .|...|||
Zfish   249 HALKLSEVQVKIWFQNRRAKWKRIKAGNVNNRSGEP 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 Homeobox 301..353 CDD:278475 32/52 (62%)
gbx1NP_777286.1 Homeobox 217..270 CDD:278475 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.