DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Antp and hoxb7

Sequence 1:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_002938071.2 Gene:hoxb7 XenbaseID:XB-GENE-5959293 Length:216 Species:Xenopus tropicalis

Alignment Length:217 Identity:94/218 (43%)
Similarity:107/218 (49%) Gaps:49/218 (22%)


  Fly   172 GMVPEGGSPPLVD--QMSGHHMNAQMTLP-----HHMG---HPQAQLGYTDVGVPDVTEVHQNHH 226
            |:.||..|.....  |.||:..:...|.|     :..|   |||:...|:.....|....  |.|
 Frog    24 GVFPEQTSCAFASNPQRSGYGSSPGSTFPAGSALYSSGSSLHPQSPAMYSSSYGLDAASF--NMH 86

  Fly   227 NMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPL-------- 283
            .....|..|.:.|                          |.||:...:::....|.|        
 Frog    87 CSPFEQNLSLMCP--------------------------TDPSKQNGTKAEQRDSELQGDTNLRI 125

  Fly   284 YPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNR 348
            ||||||...   :||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog   126 YPWMRSTGA---DRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNR 187

  Fly   349 RMKWKKENKTKGEPGSGGEGDE 370
            |||||||||......:..|..|
 Frog   188 RMKWKKENKASSPSSNSQEKQE 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 Homeobox 301..353 CDD:278475 52/52 (100%)
hoxb7XP_002938071.2 COG5576 87..>198 CDD:227863 75/140 (54%)
Homeobox 140..192 CDD:278475 52/52 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002096
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.