DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Antp and gbx2.1

Sequence 1:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_002932046.1 Gene:gbx2.1 XenbaseID:XB-GENE-855771 Length:340 Species:Xenopus tropicalis

Alignment Length:273 Identity:75/274 (27%)
Similarity:104/274 (38%) Gaps:67/274 (24%)


  Fly   132 PQQLQQQLPQVTQQVTHPQQQ-QQQPVVYASCKLQAAVGGLGM-------VPEGGSPPLVDQMSG 188
            |..|.|...|.|....||..| ...|..:.|...|    |:.:       :|.|.|.....|.:.
 Frog    62 PPSLSQATLQPTLPSAHPHHQIPSLPSGFCSSLAQ----GMALTSTLMATLPGGFSASAQHQEAA 122

  Fly   189 HHMNAQMTLPHHMGHPQAQLGYTDVGVPD-----VTEVHQNHHNMGMYQQQSGVPPV---GAPPQ 245
            ....||..        |.....:|.|..|     .|.:.:....:.....:..:.||   |....
 Frog   123 RKFGAQSL--------QGAFEKSDGGQSDGEDGNKTYITKEGTLLPFSASEVSLGPVRGQGKEES 179

  Fly   246 GMMHQGQGPPQMH---------------------QGHPGQHTPPSQNPNSQSSGMPSPLYPWMRS 289
            |...:|:|....:                     :....:.:||:.||::.|:          .|
 Frog   180 GKEAEGKGKEDSYLMDSDLDYSSDDNISCQTAHKEDDTPEESPPNSNPSNNSN----------TS 234

  Fly   290 QFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 354
            ..||   .:|.|..:|..|.||||||||..:||:...|.:|||||.|:|.|:||||||||.|||:
 Frog   235 STGK---NRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKR 296

  Fly   355 -----ENKTKGEP 362
                 .|...|||
 Frog   297 VKAGNANSKTGEP 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 Homeobox 301..353 CDD:278475 32/52 (62%)
gbx2.1XP_002932046.1 Homeobox 242..295 CDD:278475 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.