DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ftz and unpg

Sequence 1:NP_477498.1 Gene:ftz FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:397 Identity:89/398 (22%)
Similarity:141/398 (35%) Gaps:127/398 (32%)


  Fly    49 GYYPQES------YSESCYYYNN--------QEQVTTQTVPP------------VQPTTPPPKAT 87
            ||:.|..      .:..||..::        |.|...|..||            :.||.|.|..|
  Fly    91 GYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDT 155

  Fly    88 KRKAEDDAASIIAAVEERPSTLRALLTNPVKKLKYTPDYFYT-TVEQVKKAPAVSTKV---TASP 148
            :....:.||:.:|..:.....|..|:..         ||.:: :|....:..|.:.::   .|:|
  Fly   156 RFLPFNPAAAGVAPTDLSYRRLAELMNQ---------DYVHSLSVHARLQHMAAAGRMHEDQANP 211

  Fly   149 APSYDQEYVTVPTPSASEDVDYLDVYSPQSQTQKLKNGDFATPPPTTPTSLPPLEGISTPPQSPG 213
            ..:..||    |||             ||:.:...|:|..:...|.....:.  |.......|..
  Fly   212 GMAQLQE----PTP-------------PQAHSSPAKSGSHSPMEPALDVGMD--EDFECSGDSCS 257

  Fly   214 EKSSSAVSQEINHRIVTAPNGAGDFNWSHIEETLASDCKD------------------------- 253
            :.|.:...:..|..:..:.|||       ...:.:.||.|                         
  Fly   258 DISLTMSPRNYNGEMDKSRNGA-------YTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSS 315

  Fly   254 ---SKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKDRTL 315
               |:|.|..:|..|.||||:|||..:|::...|..||.:|.|||.|:||||||||.|.|:.:  
  Fly   316 NSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVK-- 378

  Fly   316 DSSPEHCGAGYTAMLPPLEATSTATTGAPSVPVPMYHHHQTTAAYPAYSHSHSHGYGLLNDYPQQ 380
                    ||.|:.......|::.|...  ||:|::                      :|.:..:
  Fly   379 --------AGLTSHGLGRNGTTSGTKIV--VPIPVH----------------------VNRFAVR 411

  Fly   381 QTHQQYD 387
            ..|||.:
  Fly   412 SQHQQLE 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:281812 43/229 (19%)
Homeobox 257..310 CDD:278475 28/53 (53%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.