DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and H2.0

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster


Alignment Length:104 Identity:24/104 - (23%)
Similarity:33/104 - (31%) Gaps:43/104 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   691 DKQAKYFLIPPAMLNEPAASRLMRKGKKLHI-YNDHTFVAVKVKGGATCNVCQQR---------- 744
            ||..||    |.||         |:.:|:|. ...|           .|.||.:|          
  Fly    16 DKTFKY----PTML---------RQHEKIHYGIKQH-----------ECEVCHRRFLHKSTLTCH 56

  Fly   745 IRSSFSKQAYQCRDC--------KMVCHKTCHYKTDAFC 775
            :|....::.|:|..|        .:.||...|....|.|
  Fly    57 MRLHTGEKPYKCPHCPKTFRGQTALNCHVFRHTNEGAKC 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787
Homeodomain 255..311 CDD:459649
KLF1_2_4_N <321..404 CDD:425360
H2.0NP_523488.2 Homeodomain 292..352 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.