DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and NKX1-1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001277008.1 Gene:NKX1-1 / 54729 HGNCID:24975 Length:448 Species:Homo sapiens


Alignment Length:356 Identity:79/356 - (22%)
Similarity:113/356 - (31%) Gaps:151/356 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 ASAGGYSSNYANATPPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTS 186
            |.|||..:  |.|.||                    :|.:...||...::.||||         |
Human   141 AGAGGVGA--AGAEPP--------------------NAGDPFKAGEAETNDTNGY---------S 174

  Fly   187 NGGGG-----------------------------GGSGAVLGGGAVGGSANGYYGGYGGGYGTAN 222
            :||||                             |...|..|||.:|...:|..|.     ...:
Human   175 SGGGGHSPSADSGDEVPDDEDDDEDEAPETEAARGAEEARGGGGGLGARGSGCQGA-----AETD 234

  Fly   223 GSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRL 287
            .|.|:|..:..:|                           |.:....:.:..|.|.         
Human   235 ASPGATVDEAAAP---------------------------GPRENSPVAQGPPGGA--------- 263

  Fly   288 RCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHV 352
                                 .:|...|:...    |.:.:.:              |..|:   
Human   264 ---------------------AAPGGAGTTPQ----GTATAAK--------------PKRKR--- 286

  Fly   353 AGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNR 417
                .||.....:|:|.|||:|..|::.||.:|...|||:...|:.:|.:|.|:|.|:|||||||
Human   287 ----TGSDSKSGKPRRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTETQVKIWFQNR 347

  Fly   418 RMKWKKDNKLPNTKNVRKKTVDANGNPTPVA 448
            |.||||.|...:|    .......|.|.|.|
Human   348 RTKWKKQNPGADT----SAPTGGGGGPGPGA 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 26/51 (51%)
NKX1-1NP_001277008.1 Homeobox 300..352 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.