DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Awh

DIOPT Version :10

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster


Alignment Length:143 Identity:35/143 - (24%)
Similarity:52/143 - (36%) Gaps:42/143 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 CDDMGSENDDMSEEDRLMLDR--------SPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYP 345
            ||..|.:. ...|:..||.||        ...|.|:..:|              |..||:     
  Fly    97 CDQCGRQL-STGEQFALMDDRVLCKAHYLETVEGGTTSSD--------------EGCDGD----- 141

  Fly   346 WMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQI 410
                        |.::  .:.||.||.:|..|:..|:..|..:.....:....||....||:|..
  Fly   142 ------------GYHK--SKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVT 192

  Fly   411 KIWFQNRRMKWKK 423
            ::||||.|.:.||
  Fly   193 QVWFQNSRARQKK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeodomain 367..423 CDD:459649 18/55 (33%)
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765 8/26 (31%)
Homeodomain 149..205 CDD:459649 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.