DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dfd and unpg

Sequence 1:NP_477201.1 Gene:Dfd FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:478 Identity:108/479 (23%)
Similarity:162/479 (34%) Gaps:176/479 (37%)


  Fly    89 YMAHHHNPHSHSHSHTHSLPHHHSNSAISGHHQASAGGYSSNYANA---TPPSHPHSH------P 144
            |.|.:|...:|..:....||     |:.:||..|     ....|.|   .||.||.:|      |
  Fly    92 YFAQNHERLTHLIAGGCYLP-----SSPAGHPAA-----QQPQAQAQPQPPPPHPPTHALEKQLP 146

  Fly   145 HAHPH------------------QSLGY----------YVH----HA--PEFISAGAVHSDPTNG 175
            ...||                  ..|.|          |||    ||  ....:||.:|.|..|.
  Fly   147 PTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANP 211

  Fly   176 YGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMM 240
            .......|                                            |..|.||..::  
  Fly   212 GMAQLQEP--------------------------------------------TPPQAHSSPAK-- 230

  Fly   241 DLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRL 305
                  |.:..|...||   ::|:.     |:...:|....::.:.:...:...|          
  Fly   231 ------SGSHSPMEPAL---DVGMD-----EDFECSGDSCSDISLTMSPRNYNGE---------- 271

  Fly   306 MLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPG------M 364
             :|:|.:...:|.:.:|..|   ||...:.               |..|...|....|      .
  Fly   272 -MDKSRNGAYTNSDSEDCSD---DEGAQSR---------------HEGGGMGGKDSQGNGSSSNS 317

  Fly   365 EPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPN 429
            :.:|:|||:|..|:||||:|||..:||:...|.:||.:|.|||.|:||||||||.|||:      
  Fly   318 KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR------ 376

  Fly   430 TKNVRKKTVDANG---NPTPVAKK---PTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDS 488
                .|..:.::|   |.|....|   |.....::...::|.||..:...:...|.:.:.:   |
  Fly   377 ----VKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKL---S 434

  Fly   489 LESIG---------DVSSSLGNP 502
            .|:||         :.||..|.|
  Fly   435 AEAIGGFEKFSGSTNASSPSGGP 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 32/52 (62%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.