DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and TLX1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_011538046.1 Gene:TLX1 / 3195 HGNCID:5056 Length:342 Species:Homo sapiens


Alignment Length:431 Identity:98/431 - (22%)
Similarity:142/431 - (32%) Gaps:160/431 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNG--YGPAANVPNTSNG----------GGGG 192
            ||   |.||.       |..|.......:.:.|..|  .|||:.:.:...|          .|||
Human     6 PH---HLHPG-------HAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGG 60

  Fly   193 GSGAVLGGGAVGGSANGYYGGYG------------------------------GGYGTANGSVGS 227
            ||.|..|.|..|....|..||.|                              ||.|.::|..|:
Human    61 GSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSSGGAGA 125

  Fly   228 THSQG------HSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQEL-GM 285
            ..:.|      |.|         ...:...|...|.||..:         .:|||...:..| |:
Human   126 LSAAGVIRVPAHRP---------LAGAVAHPQPLATGLPTV---------PSVPAMPGVNNLTGL 172

  Fly   286 RLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKI 350
            ..    ...|::....:||..:..||                        .|...||.:|     
Human   173 TF----PWMESNRRYTKDRFTVALSP------------------------FTVTRRIGHP----- 204

  Fly   351 HVAGVANGSYQPGMEPKRQ--RTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIW 413
                     ||....||::  ||::||.||.||||.||..:||....|..:|..|.:::.|:|.|
Human   205 ---------YQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTW 260

  Fly   414 FQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQ------QQQQSQQQ 472
            |||||.||::.                           |......::|||.      ||:..|:.
Human   261 FQNRRTKWRRQ---------------------------TAEEREAERQQANRILLQLQQEAFQKS 298

  Fly   473 QTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPAAPETTS 513
            ..|..|....|:.:.||.::.::.      |:...:.:.||
Human   299 LAQPLPADPLCVHNSSLFALQNLQ------PWSDDSTKITS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 26/51 (51%)
TLX1XP_011538046.1 Homeobox 216..269 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.