DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and ceh-9

DIOPT Version :10

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001021797.1 Gene:ceh-9 / 267057 WormBaseID:WBGene00000434 Length:147 Species:Caenorhabditis elegans


Alignment Length:75 Identity:31/75 - (41%)
Similarity:47/75 - (62%) Gaps:7/75 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK-------D 424
            |:.||.::..|:.||||:|...:||:...|.|:|..|.::|.|:||||||||.||||       .
 Worm    71 KKARTTFSGKQVFELEKQFEAKKYLSSSDRSELAKRLDVTETQVKIWFQNRRTKWKKIESEKERS 135

  Fly   425 NKLPNTKNVR 434
            .::|:.:.|:
 Worm   136 GEIPDDQIVK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeodomain 367..423 CDD:459649 27/55 (49%)
ceh-9NP_001021797.1 Homeodomain 71..127 CDD:459649 27/55 (49%)

Return to query results.
Submit another query.