Sequence 1: | NP_477201.1 | Gene: | Dfd / 40832 | FlyBaseID: | FBgn0000439 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025036.2 | Gene: | DBX1 / 120237 | HGNCID: | 33185 | Length: | 343 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 49/207 - (23%) |
---|---|---|---|
Similarity: | 86/207 - (41%) | Gaps: | 49/207 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 358 GSYQPGM--------------------------EPKR---QRTAYTRHQILELEKEFHYNRYLTR 393
Fly 394 RRRIEIAHTLVLSERQIKIWFQNRRMKWK--KDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAA 456
Fly 457 SKKQQQAQQQQQSQQ--QQTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPAAPETTSSYPGSQ 519
Fly 520 QHLSNNNNNGSG 531 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dfd | NP_477201.1 | Homeobox | 370..422 | CDD:278475 | 22/51 (43%) |
DBX1 | NP_001025036.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 56..100 | ||
Homeobox | 184..237 | CDD:278475 | 22/52 (42%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 240..343 | 20/111 (18%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |