DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and DBX1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001025036.2 Gene:DBX1 / 120237 HGNCID:33185 Length:343 Species:Homo sapiens


Alignment Length:207 Identity:49/207 - (23%)
Similarity:86/207 - (41%) Gaps:49/207 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 GSYQPGM--------------------------EPKR---QRTAYTRHQILELEKEFHYNRYLTR 393
            ||:||.:                          :|:|   :|..::..|...|||.|...:|:::
Human   144 GSFQPFIRSSYFPASSSVVPIPGTFSWPLAARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISK 208

  Fly   394 RRRIEIAHTLVLSERQIKIWFQNRRMKWK--KDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAA 456
            ..|.::|..|.|.:.|:|||||||||||:  |:.:|.::...|::|:....||.|......::..
Human   209 PDRKKLAAKLGLKDSQVKIWFQNRRMKWRNSKERELLSSGGCREQTLPTKLNPHPDLSDVGQKGP 273

  Fly   457 SKKQQQAQQQQQSQQ--QQTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPAAPETTSSYPGSQ 519
            ..::::......|.:  ......|   :.:|...|            |..:|.:|..:|| ||..
Human   274 GNEEEEEGPGSPSHRLAYHASSDP---QHLRDPRL------------PGPLPPSPAHSSS-PGKP 322

  Fly   520 QHLSNNNNNGSG 531
            ...|::.....|
Human   323 SDFSDSEEEEEG 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/51 (43%)
DBX1NP_001025036.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..100
Homeobox 184..237 CDD:278475 22/52 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..343 20/111 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.